किसी का भी WiFi Password कैसे पता करें How To See The WiFi Password on ANY Android Phone 100%
Watch किसी का भी WiFi Password कैसे पता करें How To See The WiFi Password on ANY Android Phone 100% With HD Quality
द्वारा Mobile Technical Guru| 16785 दृश्य
Watch HOW TO GET FREE WIFI CONNECT WITH YOUR WIFI IN (IN HINDI) With HD Quality
द्वारा KUCH BHI BOLO| 1041 दृश्य
Union Budget 2018: Working to provide WiFi, CCTV Cameras on all trains, Railways stations. Union Finance Minister Arun Jaitley has begun the presentation of Union Budget 2018 in the Parliament on Thursday. Speaking in the Parliament, FM Jaitley said they are in a process of eliminating unmanned railway crossings. All railway stations having more than 25,000 footfalls will have escalators. They are also working to provide WiFi and CCTV Cameras on all trains and Railways Stations.
For More Latest News Update Do Not Forget To Subscribe
Watch Budget 2018: Railway Stations पर अब लगेगा WiFi और CCTV| WiFi, Cameras on all train, Railways station With HD Quality
द्वारा Delhi Darpan TV| 1767 दृश्य
DIGISOL DG WR3001NE Wireless Repeater unboxing and setup telugu
DIGISOL : https://amzn.to/2WieSis
Watch Extend your wifi range with wifi repeater DIGISOL telugu With HD Quality
द्वारा Telugu TechTuts| 717 दृश्य
Jio अब दे सकता है कॉलेजों कॉलेजों में फ्री WiFi | Jio Free Wifi In Colleges | News Remind
Watch Jio अब दे सकता है कॉलेजों कॉलेजों में फ्री WiFi | Jio Free Wifi In Colleges | News Remind With HD Quality
द्वारा News Remind| 387 दृश्य
జియోకు కొత్త కంపెనీ షాక్! Jio News Plans | Wifi Dabba Latest News | Wifi Dabba New Offers
#JoOffers #WifiDabbaOffers
Top Telugu TV Channel Is All About #Entertainment.. We Bring all the latest Updates on #Films, #UnknownFacts, #Education, #Politics, etc. Watch #Trailers, #FunnyVideos, #ComedyVideos, #Pranks, #Gossips, #Trailers, #Interviews, #CelebrityInterviews, #UnknownFacts etc. #TopTeluguTV Is A One Stop Entertainment.
Top Telugu TV is the Well Known Telugu News channel Across Telangana and Andhra Pradesh. Telugu Real Facts, Telugu Live news gives 24/7 Hours live news, covering Indian political news, sports news, Entertainment news, Celebrities Interviews,Facebook&Promotions of Celebrities, live events, comedy Telugu web series and Tollywood movie promotions, Free Telugu News Channel, 24/7 news Telugu channel
Telugu, Language Channel owned by Bhavitha Sri Media House Pvt Ltd.
And Subscribe My Channels
1)Top Telugu TV
https://bit.ly/2my9wje
2)SPOT NEWS
https://bit.ly/2mxFaNP
3)SAMSKRUTHI TV
https://bit.ly/2mxlFos
4)TOP ANDHRA TV
https://bit.ly/2o0LDBa
5)TOP TELANGANA TV
https://bit.ly/2nsRij4
6)TOP TELUGU FITNESS
https://bit.ly/2mxMdGf
7)TOP TELUGU TV ORIGINALS
https://bit.ly/2nq9VUW
8)TOP TELUGU KITCHEN
https://bit.ly/2nq9VnV
9)TOP TELUGU TV MUSIC
https://bit.ly/2lQdL9s
Follow ...
Website: https://www.toptelugutv.com
Facebook: https://www.facebook.com/toptelugutvchannel/
Twitter : https://twitter.com/TopTeluguTV/
Subscribe: https://www.youtube.com/channel/UC8Dj-LDol8r7zGnhn0onF0A
Instagram: https://www.instagram.com/toptelugutv/?hl=en
Watch జియోకు కొత్త కంపెనీ షాక్! Jio News Plans | Wifi Dabba Latest News | Wifi Dabba New Offers With HD Quality
द्वारा Top Telugu TV| 437 दृश्य
Download Link Dr Phone Android Root:
https://drfone.wondershare.com/android-root.html?utm_source=youtube_videos&utm_medium=techduniyahindi&utm_campaign=androidroot
FB: https://www.facebook.com/drfonetoolkit/
Ins: https://www.instagram.com/drfone_toolkit/
Twitter: https://twitter.com/drfone_toolkit/
You are still having problem to Root your Android Phone . Here we go i am Manoj kumar and in this video Guide You Will Learn How You can root your Android Phone , Tablet Using Dr fone Android Root .
Hope you enjoyed this video and don't forget to Like and subscribe us
Subscribe Us :
https://www.youtube.com/channel/UCzOvbNNTLuGV2GQwPQ0Gezw?sub_confirmation=1
Like us on facebook : https://www.facebook.com/Techduniya1/
follow us on Twitter : https://twitter.com/TechDuniya1
Visit Our Website : http://www.Techduniya.in
Watch How to Root Android Device Using Dr Fone Android Root {100% Working} With HD Quality
द्वारा Tech Duniya Hindi| 12351 दृश्य
subscribe Tech Duniya Hindi : https://www.youtube.com/channel/UCzOvbNNTLuGV2GQwPQ0Gezw?sub_confirmation=1
Namskar Dosto is video me maine aapko bataya hai ki kaise aap apne personal files and folder ko aasani se chupa sakte hai
calculatot se , Dosto ye bahut accha tareeka hai kyuki aapke dosto ko kabhi pta ni lagega ki aapne koi photo ya video unse
chipayi hai Mujhe umeed hai ye video aapko jarur pasand aayega .
Hello friends i this video You will learn how you can hide your personal photo and video using calculator , So if You want to
know How you can Hide or lock your files , photo or video in android phone then please watch this video till end .
I hope you enjyoed This video and it will very helpful for you Do not forget to subscribe Tech Duniya Hindi
Click Here for subscribe Tech Duniya Hindi : https://www.youtube.com/channel/UCzOvbNNTLuGV2GQwPQ0Gezw?sub_confirmation=1
Like us on facebook : https://www.facebook.com/Techduniya1/
follow us on Twitter : https://twitter.com/TechDuniya1
Visit Our Website : http://www.Techduniya.inWatch How to Hide Photo and Video Using Calculator | Best Way To Hide Personal Files in Android With HD Quality
द्वारा Tech Duniya Hindi| 2390 दृश्य
learn how to secretly hide files and folders on mobile Telugu,How to Hide Photo and Video Using Calculator | Best Way To Hide Personal Files in Android
Link : http://viid.me/qrxUK9
hafiztime
hafiz telugu videos
Watch How to Hide Photo and Video Using Calculator | Easy Way To Hide Personal Files in Android With HD Quality
द्वारा Telugu TechTuts| 1212 दृश्य
Click here for Subscribe : https://www.youtube.com/channel/UCzOvbNNTLuGV2GQwPQ0Gezw?sub_confirmation=1
Welcome to Tech Duniya Hindi , Dosto aaj ke is video me main aapko bataya hai ki kaise aap bina usb cable ke aasani se apne phone se apne laptop me data transfer kar sakte hai vo bhi bina USB cable ka use kiye , aap wifi ke through apne pc ya phir laptop me data transfer kar sakte hai , mujhe ummeed hai ki ye video aapke liye pasand aaya hoga . agar pasand aaya hai to hmare channel tech duniya hindi ko subscribe karna na bhule .
Hello Friends in this video i will teach you how you can easily transfer your files from android phone to pc without using of USB cable , we can transfer our data from phone to pc using wifi , So thanks for watching , i hope you enjoyed this video and it will be very helpful for you , so don't forget to Subscribe Us for more videos on mobile computer technology or internet in hindi
Click here for Subscribe : https://www.youtube.com/channel/UCzOvbNNTLuGV2GQwPQ0Gezw?sub_confirmation=1
Like us on facebook : https://www.facebook.com/Techduniya1/
follow us on Twitter : https://twitter.com/TechDuniya1
Visit Our Website : http://www.Techduniya.in
Watch How to Copy files from Android to PC Using Wifi फोन से पीसी मे कैसे डेटा काँपी करे वाई फाई से With HD Quality
#androiddatatransferusingwifi#howtotransferdatausingwifi#datatransferwithoutusbcable#phonesepcmewifisekaisedatatransferkre#androidphonetopcdatatransfer#howtocopydatafrompctoandroid
Realme P2 Pro 5G Mobile Unboxing and Initial Impressions
#realme #realmep2pro #unboxing #telugutechtuts
Get in Touch With Me :
Follow Me on Telegram : https://telegram.me/telugutechtuts
Follow me on Fb: https://www.facebook.com/telugutechtutsofficial
Follow me on Twitter : https://twitter.com/hafizsd
Follow Me on Instagram: https://www.instagram.com/telugutechtuts/
Realme P2 Pro 5G Mobile Unboxing and Initial Impressions || in Telugu
द्वारा Telugu TechTuts| 1499 दृश्य
vivo T3 Ultra 5G Mobile Unboxing & First Look
This is Flipkart exclusive Use "TeleguTechTutsT3U" First 500 users with get Rs 500 off..
#vivo #vivot3ultra #unboxing #mobile
Get in Touch With Me :
Follow Me on Telegram : https://telegram.me/telugutechtuts
Follow me on Fb: https://www.facebook.com/telugutechtutsofficial
Follow me on Twitter : https://twitter.com/hafizsd
Follow Me on Instagram: https://www.instagram.com/telugutechtuts/
vivo T3 Ultra 5G Mobile Unboxing & First Look || MTD 9200+ || in Telugu
द्वारा Telugu TechTuts| 219 दृश्य
Realme Narzo 70 Turbo Unboxing & Initial Impressions
Link: https://buy.realme.com/in/goods/724
#realmeNarzo70TurboUnboxing #realmeNARZO70Turbo5G #TurboPerformance #unboxingtelugu
Get in Touch With Me :
Follow Me on Telegram : https://telegram.me/telugutechtuts
Follow me on Fb: https://www.facebook.com/telugutechtutsofficial
Follow me on Twitter : https://twitter.com/hafizsd
Follow Me on Instagram: https://www.instagram.com/telugutechtuts/
Realme Narzo 70 Turbo Unboxing & Initial Impressions || 90FPS Gaming || Telugu Tech Tuts
द्वारा Telugu TechTuts| 299 दृश्य
Robotic Process Automation enables users to create software robots, or #Bots, that can observe, mimic & execute repetitive, time consuming #Digital #business processes by studying human actions.
Watch the video to know how RPA is transforming #businesses.
#ArtificialIntelligence
Robotic Process Automation is transforming businesses across the world
द्वारा CII| 209872 दृश्य
Mr Bhupesh Baghel, CM, Chhattisgarh in conversation with Dr Jyotsna Suri, Past President, FICCI at #FICCIAGM.
#FICCI #IndianEconomy #Economy #India
Watch Mr Bhupesh Baghel, CM, Chhattisgarh at #FICCIAGM With HD Quality
द्वारा FICCI India| 640031 दृश्य
अनूठे "रक्षा -सूत्र " से बांधी डोर विश्वास की
Watch अनूठे "रक्षा -सूत्र " से बांधी डोर विश्वास की With HD Quality
द्वारा P P Chaudhary| 3802692 दृश्य
Blatant Violation of model code of conduct in Odisha
Watch Blatant Violation of model code of conduct in Odisha With HD Quality
द्वारा Dharmendra Pradhan| 827966 दृश्य
Subscribe Now - http://bit.ly/2ofH4S4 Stay Updated! ????
• Facebook - http://facebook.com/BJP4India
• Twitter - http://twitter.com/BJP4India
• Instagram - http://instagram.com/bjp4india
• Linkedin- https://www.linkedin.com/company/bharatiya-janata-party/
Press Conference by Union Minister of Jal Shakti Shri Gajendra Singh Shekhawat at BJP HQ.
द्वारा Bharatiya Janata Party Delhi| 76029 दृश्य
Prime Minister Narendra Modi
---------------------------------------------------------------------------
►Subscribe https://goo.gl/C3hVED | to Prime Minister Office’s official Youtube channel.
Get the latest updates ???? from PM’s Office: news, speeches, public outreach, national events, official state visits, PM’s foreign visits, and much more...
You can also connect with us on the official PMO website & other Social Media channels –
►Website – http://www.pmindia.gov.in
►Facebook – https://www.facebook.com/PMOIndia
►Twitter – https://twitter.com/PMOIndia
►Instagram – https://www.instagram.com/pmoindia
India observes Independence Day with patriotic fervour
द्वारा PMOfficeIndia| 256188 दृश्य
किसी का भी WiFi Password कैसे पता करें How To See The WiFi Password on ANY Android Phone 100%
Watch किसी का भी WiFi Password कैसे पता करें How To See The WiFi Password on ANY Android Phone 100% With HD Quality
द्वारा Mobile Technical Guru| 16785 दृश्य
Watch HOW TO GET FREE WIFI CONNECT WITH YOUR WIFI IN (IN HINDI) With HD Quality
द्वारा KUCH BHI BOLO| 1041 दृश्य
Union Budget 2018: Working to provide WiFi, CCTV Cameras on all trains, Railways stations. Union Finance Minister Arun Jaitley has begun the presentation of Union Budget 2018 in the Parliament on Thursday. Speaking in the Parliament, FM Jaitley said they are in a process of eliminating unmanned railway crossings. All railway stations having more than 25,000 footfalls will have escalators. They are also working to provide WiFi and CCTV Cameras on all trains and Railways Stations.
For More Latest News Update Do Not Forget To Subscribe
Watch Budget 2018: Railway Stations पर अब लगेगा WiFi और CCTV| WiFi, Cameras on all train, Railways station With HD Quality
द्वारा Delhi Darpan TV| 1767 दृश्य
DIGISOL DG WR3001NE Wireless Repeater unboxing and setup telugu
DIGISOL : https://amzn.to/2WieSis
Watch Extend your wifi range with wifi repeater DIGISOL telugu With HD Quality
द्वारा Telugu TechTuts| 717 दृश्य
Jio अब दे सकता है कॉलेजों कॉलेजों में फ्री WiFi | Jio Free Wifi In Colleges | News Remind
Watch Jio अब दे सकता है कॉलेजों कॉलेजों में फ्री WiFi | Jio Free Wifi In Colleges | News Remind With HD Quality
द्वारा News Remind| 387 दृश्य
జియోకు కొత్త కంపెనీ షాక్! Jio News Plans | Wifi Dabba Latest News | Wifi Dabba New Offers
#JoOffers #WifiDabbaOffers
Top Telugu TV Channel Is All About #Entertainment.. We Bring all the latest Updates on #Films, #UnknownFacts, #Education, #Politics, etc. Watch #Trailers, #FunnyVideos, #ComedyVideos, #Pranks, #Gossips, #Trailers, #Interviews, #CelebrityInterviews, #UnknownFacts etc. #TopTeluguTV Is A One Stop Entertainment.
Top Telugu TV is the Well Known Telugu News channel Across Telangana and Andhra Pradesh. Telugu Real Facts, Telugu Live news gives 24/7 Hours live news, covering Indian political news, sports news, Entertainment news, Celebrities Interviews,Facebook&Promotions of Celebrities, live events, comedy Telugu web series and Tollywood movie promotions, Free Telugu News Channel, 24/7 news Telugu channel
Telugu, Language Channel owned by Bhavitha Sri Media House Pvt Ltd.
And Subscribe My Channels
1)Top Telugu TV
https://bit.ly/2my9wje
2)SPOT NEWS
https://bit.ly/2mxFaNP
3)SAMSKRUTHI TV
https://bit.ly/2mxlFos
4)TOP ANDHRA TV
https://bit.ly/2o0LDBa
5)TOP TELANGANA TV
https://bit.ly/2nsRij4
6)TOP TELUGU FITNESS
https://bit.ly/2mxMdGf
7)TOP TELUGU TV ORIGINALS
https://bit.ly/2nq9VUW
8)TOP TELUGU KITCHEN
https://bit.ly/2nq9VnV
9)TOP TELUGU TV MUSIC
https://bit.ly/2lQdL9s
Follow ...
Website: https://www.toptelugutv.com
Facebook: https://www.facebook.com/toptelugutvchannel/
Twitter : https://twitter.com/TopTeluguTV/
Subscribe: https://www.youtube.com/channel/UC8Dj-LDol8r7zGnhn0onF0A
Instagram: https://www.instagram.com/toptelugutv/?hl=en
Watch జియోకు కొత్త కంపెనీ షాక్! Jio News Plans | Wifi Dabba Latest News | Wifi Dabba New Offers With HD Quality
द्वारा Top Telugu TV| 437 दृश्य
Download Link Dr Phone Android Root:
https://drfone.wondershare.com/android-root.html?utm_source=youtube_videos&utm_medium=techduniyahindi&utm_campaign=androidroot
FB: https://www.facebook.com/drfonetoolkit/
Ins: https://www.instagram.com/drfone_toolkit/
Twitter: https://twitter.com/drfone_toolkit/
You are still having problem to Root your Android Phone . Here we go i am Manoj kumar and in this video Guide You Will Learn How You can root your Android Phone , Tablet Using Dr fone Android Root .
Hope you enjoyed this video and don't forget to Like and subscribe us
Subscribe Us :
https://www.youtube.com/channel/UCzOvbNNTLuGV2GQwPQ0Gezw?sub_confirmation=1
Like us on facebook : https://www.facebook.com/Techduniya1/
follow us on Twitter : https://twitter.com/TechDuniya1
Visit Our Website : http://www.Techduniya.in
Watch How to Root Android Device Using Dr Fone Android Root {100% Working} With HD Quality
द्वारा Tech Duniya Hindi| 12351 दृश्य
subscribe Tech Duniya Hindi : https://www.youtube.com/channel/UCzOvbNNTLuGV2GQwPQ0Gezw?sub_confirmation=1
Namskar Dosto is video me maine aapko bataya hai ki kaise aap apne personal files and folder ko aasani se chupa sakte hai
calculatot se , Dosto ye bahut accha tareeka hai kyuki aapke dosto ko kabhi pta ni lagega ki aapne koi photo ya video unse
chipayi hai Mujhe umeed hai ye video aapko jarur pasand aayega .
Hello friends i this video You will learn how you can hide your personal photo and video using calculator , So if You want to
know How you can Hide or lock your files , photo or video in android phone then please watch this video till end .
I hope you enjyoed This video and it will very helpful for you Do not forget to subscribe Tech Duniya Hindi
Click Here for subscribe Tech Duniya Hindi : https://www.youtube.com/channel/UCzOvbNNTLuGV2GQwPQ0Gezw?sub_confirmation=1
Like us on facebook : https://www.facebook.com/Techduniya1/
follow us on Twitter : https://twitter.com/TechDuniya1
Visit Our Website : http://www.Techduniya.inWatch How to Hide Photo and Video Using Calculator | Best Way To Hide Personal Files in Android With HD Quality
द्वारा Tech Duniya Hindi| 2390 दृश्य
learn how to secretly hide files and folders on mobile Telugu,How to Hide Photo and Video Using Calculator | Best Way To Hide Personal Files in Android
Link : http://viid.me/qrxUK9
hafiztime
hafiz telugu videos
Watch How to Hide Photo and Video Using Calculator | Easy Way To Hide Personal Files in Android With HD Quality
द्वारा Telugu TechTuts| 1212 दृश्य
Bigg Boss 18 | Boss Meter Trend Me Elvish Yadav Ki Entry, Vivian vs Rajat Dalal
#biggboss18 #viviandsena
- Stay Tuned For More Bollywood News
☞ Check All Bollywood Latest Update on our Channel
☞ Subscribe to our Channel https://goo.gl/UerBDn
☞ Like us on Facebook https://goo.gl/7Q896J
☞ Follow us on Twitter https://goo.gl/AjQfa4
☞ Circle us on G+ https://goo.gl/57XqjC
☞ Follow us on Instagram https://goo.gl/x48yEy
Bigg Boss 18 | Boss Meter Trend Me Elvish Yadav Ki Entry, Vivian vs Rajat Dalal
द्वारा Bollywood Spy| 907 दृश्य
Bigg Boss 18 LATEST Voting Trend | Kise Mil Rahe Hai Highest Votes? Chahat Pandey Leading?
Follow Aditi On Instagram - https://www.instagram.com/pihuaditi/
Bigg Boss 18 LATEST Voting Trend | Kise Mil Rahe Hai Highest Votes? Chahat Pandey Leading?
द्वारा Bollywood Spy| 846 दृश्य
Poulomi Das Eviction Explosive Interview - Bigg Boss OTT 3
#poulomidas #biggbossott3 #biggbossott #biggboss
Poulomi Das Eviction Explosive Interview - Bigg Boss OTT 3
द्वारा BOLLYWOOD FLASH| 765 दृश्य
Check out the video to know more.
SUBSCRIBE To Bollywood Bubble:
Click Here ► http://bit.ly/2hjMB6X
Tune into Bollywood Bubble, your one stop destination for all the latest happenings, hot gossips, rumours and exclusive B-Town news...
Also, Visit - https://www.bollywoodbubble.com . One stop Destination for Latest Bollywood Updates.
Follow us on Instagram - https://www.instagram.com/bollywoodbubble/
Like us on Facebook - https://www.facebook.com/BollywoodBubble
Follow us on Twitter - https://twitter.com/bollybubble
Click on the Subscribe Button NOW and Stay Tuned.
"Nishant forced me to go to Bigg Boss 18" - Nyra Banerjee #shorts #biggboss18
द्वारा Bollywood Bubble| 893 दृश्य
Bigg Boss 18 | Vivian D'Sena Ko Chahat Se Nafrat Padegi Mehengi
#biggboss18 #viviandsena
- Stay Tuned For More Bollywood News
☞ Check All Bollywood Latest Update on our Channel
☞ Subscribe to our Channel https://goo.gl/UerBDn
☞ Like us on Facebook https://goo.gl/7Q896J
☞ Follow us on Twitter https://goo.gl/AjQfa4
☞ Circle us on G+ https://goo.gl/57XqjC
☞ Follow us on Instagram https://goo.gl/x48yEy
Bigg Boss 18 | Vivian D'Sena Ko Chahat Se Nafrat Padegi Mehengi
द्वारा Bollywood Spy| 807 दृश्य
Bigg Boss 18 LATEST Voting Trend | Chahat Vs Karan Kisko Mil Rahe Highest Votes
Follow Aditi On Instagram - https://www.instagram.com/pihuaditi/
Bigg Boss 18 LATEST Voting Trend | Dhadam Gir Rahe Hai Iske Votes, Shocking Badlav
द्वारा Bollywood Spy| 784 दृश्य
Check out the video to know more.
SUBSCRIBE To Bollywood Bubble:
Click Here ► http://bit.ly/2hjMB6X
Tune into Bollywood Bubble, your one stop destination for all the latest happenings, hot gossips, rumours and exclusive B-Town news...
Also, Visit - https://www.bollywoodbubble.com . One stop Destination for Latest Bollywood Updates.
Follow us on Instagram - https://www.instagram.com/bollywoodbubble/
Like us on Facebook - https://www.facebook.com/BollywoodBubble
Follow us on Twitter - https://twitter.com/bollybubble
Click on the Subscribe Button NOW and Stay Tuned.
Is Shehnaaz Gill the most successful Bigg Boss contestant ever? #biggboss #shorts
द्वारा Bollywood Bubble| 972 दृश्य
Kajal Aggarwal Ventures into the Home Lifestyle Space with her Exclusive Brand Licensing ProgramDo Follow Us On
Instagram - @Bollywoodflash01
Facebook - @Bollywoodflashhd
Twitter - @Bollywoodflash1
YouTube - https://www.youtube.com/channel/UCtO0JBGfHmBRRadsEdzlJng
Kajal Aggarwal Ventures into the Home Lifestyle Space with her Exclusive Brand Licensing Program
द्वारा BOLLYWOOD FLASH| 902 दृश्य
Check out the video to know more.
SUBSCRIBE To Bollywood Bubble:
Click Here ► http://bit.ly/2hjMB6X
Tune into Bollywood Bubble, your one stop destination for all the latest happenings, hot gossips, rumours and exclusive B-Town news...
Also, Visit - https://www.bollywoodbubble.com . One stop Destination for Latest Bollywood Updates.
Follow us on Instagram - https://www.instagram.com/bollywoodbubble/
Like us on Facebook - https://www.facebook.com/BollywoodBubble
Follow us on Twitter - https://twitter.com/bollybubble
Click on the Subscribe Button NOW and Stay Tuned.
“People call us Momo, Corona” - Bigg Boss 18 contestant Chum Darang on discrimination #biggboss18
द्वारा Bollywood Bubble| 851 दृश्य
Bigg Boss 18 | Gharwalon Ne Kiya Avinash Mishra Ko EVICT
#biggboss18 #viviandsena #rajatdalal
- Stay Tuned For More Bollywood News
☞ Check All Bollywood Latest Update on our Channel
☞ Subscribe to our Channel https://goo.gl/UerBDn
☞ Like us on Facebook https://goo.gl/7Q896J
☞ Follow us on Twitter https://goo.gl/AjQfa4
☞ Circle us on G+ https://goo.gl/57XqjC
☞ Follow us on Instagram https://goo.gl/x48yEy
Bigg Boss 18 | Gharwalon Ne Kiya Avinash Mishra Ko EVICT
द्वारा Bollywood Spy| 838 दृश्य
4GB + 64GB - Rs. 13,990
6GB + 64GB - Rs. 15,990
8GB + 128GB - Rs. 17,990
Realme 2 Pro ,Real Pro Smartphone ,AI Beauty Mode ,Corner Bezel , Snapdragon 660 ,6.3 inch Screen FHD+ , AI Dual Rear Camera , Color OS , AIE Processor , Dual VoLTE , Smart Scan (India) ,Safety Protection
Subscribe Us :
https://www.youtube.com/channel/UCzOvbNNTLuGV2GQwPQ0Gezw?sub_confirmation=1
Like us on facebook : https://www.facebook.com/Techduniya1/
follow us on Twitter : https://twitter.com/TechDuniya1
Visit Our Website : http://www.Techduniya.in
Tech Duniya (हिन्दी) youtube channel provides daily new ideas , tips and tricks about Android Computer, Internet ,Facebook, Youtube, Mobile, Google ,Twitter ,Yahoo internet security, Data Security, Discovering New Technology, Website Development , Design And Web Hosting Services / Domain Registration and make money online Tips & Tricks Online Classes.
द्वारा Tech Duniya Hindi| 64531 दृश्य
1. Batch Rename Files or Folders
ES File Explorer allows you to rename files in bulk on your Android device. First go to the location where you want to rename files or folders, and then tap and press until you see a checkmark on the file or folder. When your first file is checked press the “checkmark” button on the app to select multiple files at once. Now tap the “Rename” button.
A new window “Batch Rename” will appear. You can assign filename + number, add a starting number, or you can add any name before your original filename
2. Copy and Paste Multiple Times
ES File Explorer has a powerful clipboard which allows users to paste files and folders multiple times. Select your files and press “Copy” or “Cut” on the toolbar. Now paste that file in the chosen destination.
After you copied something press the “Windows” button on the toolbar and tap “Clipboard” on top right corner of the app to see the files stored in your clipboard. You can paste the contents of the clipboard to any directory as many times as you want.
Once you are done press the “Clear” button to clear the clipboard. If you exit from the app at that moment then your clipboard will be cleared automatically.
3. Search Local Files
ES File Explorer gives users an option to search files on their device by keyword or category. To search by keywords, click “Search” on the toolbar and type your keywords (such as mp3, text, PDF, and more) to search for files. To search by category click the “search icon” on the top corner and select the category (images, audio, video, apk, document).
If you can’t find your files for some reason you can perform an advanced search where you can search for files according to their size and the date they were modified or created.
4. Change Folder Properties
If you have rooted your device then you can use root explorer in ES File Explorer to change folder properties. Slide the toolbar from the left, go to
द्वारा Tech Duniya Hindi| 1096 दृश्य
![[हिंन्दी-Hindi] Original vs pirated windows | Why we Should use Genuine Operating System](https://vbcdn.com/cdn/download/201808311535691360955830DpnkTZnpwlw.jpg)
Read More on our website : http://www.techduniya.in/difference-between-genuine-or-pirated-os/
दोस्तो जब कभी भी आप नया Laptop या Desktop खरीदने जाते है तो आप एक चीज के बारे मे जरूर सुनते होंगे कि इस Laptop या Desktop के साथ आपको Geniune Windows मिलती है या फिर ये Laptop या Desktop DOS ya Linux के साथ आता है ।
क्या होते है Pirated और Geniune Windows ?
दोस्तो windows , DOS , UNIX , Linux ये सभी Operating System hai jo ki kise machine ke working ke liye jaruri hote hai , Agar aap ek simple user hai to aapko aapke PC me Windows Operating System ki jarurat hoti hai , Lekin jab aap market me new laptop ya desktop kharedne jate hai to aapko windows based aur Dos Based Laptop milte hai . Dos based Laptop ek General User ke liye ni hote hai , Ydi aap ek Dos based Laptop khareedte hai to aapko bad me usme windows operating system hi install karna rahta hai . Lekin jankari ke अभाव me aap Pirated ya चोरी kiya hua Operating system use karne lagte hai , Jo ki aapke Laptop ke security ke liye bhi khatarnak ho sakta hai .
Dosto jab aap ek Geniune Windows laptop ya desktop lete hai to uski keemat 3-4 hajar Rupay jyada Hoti hai , vhi aap ek dos ya linux based laptop kharedte hai to uski keemat kam hoti hai . Lekin ye keemat aapse orignal Windows ki li jati hai . ydi aapke Dos wala koi Laptop lete hai to aapko usme Pirated Windows install karke de diya jata hai .
Pirated Windows use karne ke Nuskan :
1 : Dosto sabse pahli bat Pirated operating system Genuine ki copy hote hai , yani ki inhe chori bhi kha ja sakta hai , ydi aap ek pirated Operating system use karte hai to aap par Legal action bhi liya ja sakta hai .
2 : Pirated Operating system kisi hacker ya aise kisi group se diye jate hai jo ki Software ko crack karte hai , Dosto ye log Pirated wale operating system me apne code ko bhi dal sakte hai , jisse bad me ye aasani se aapke system ko hack kar sakte hai .
3. Agar aap ek Orignal Windows us
द्वारा Tech Duniya Hindi| 2531 दृश्य
सोमवार को वित्त मंत्री निर्मला सीतारमण के अध्यक्षता में GST काउंसिल की अहम बैठक का आयोजन किया गया.. इस बैठक में मुख्य रूप से दो मुद्दों पर चर्चा होनी थीं…. हेल्थ इंश्योरेंस पर जीएसटी की दरें कम करने, और 2000 रुपये से कम के ऑनलाइन (डेबिट और क्रेडिट कार्ड से) ट्रांजेक्शन पर 18% जीएसटी लगाने का मामला था…. फिलहाल इंश्योरेंस प्रीमियम सस्ता होने नहीं जा रहा है, क्योंकि इस मसले पर अंतिम फैसला अगली बैठक तक के लिए टाल दिया गया है…
#gst #gstcoucilmeeting #goodsandservicestax #taxation #topnews #nirmalasitharaman #financeminister
Subscribe to our YouTube channel: https://bit.ly/PunjabKesariTV
Also, Watch ►
Latest News & Updates ► https://bit.ly/PunjabKesariTVLatestNews
Latest News On Jammu & Kashmir ► https://bit.ly/JammuKashmirNews
Delhi News Updates | Punjab Kesari TV ► https://bit.ly/LatestDelhiNewsUpdates
Latest Updates On West Bengal ► https://bit.ly/LatestWestBengalNews
Viral Videos | Punjab Kesari TV ► https://bit.ly/LatestViralVideos
Punjab Kesari National | Latest News & Updates ► https://bit.ly/LatestNationalNews
Exclusive Interviews ► https://bit.ly/PunjabKesariTV-ExclusiveInterviews
Russia Ukraine Crisis Live Updates ► https://bit.ly/UkraineRussiaCrisisUpdates
Latest Updates On International News ► https://bit.ly/LatestInternationalNews
Follow us on Twitter: https://twitter.com/punjabkesari
Like us on FB: https://www.facebook.com/Pkesarionline/
GST Council Meeting: क्या सस्ता-क्या महंगा हुआ?,Nirmala Sitharaman ने कर दिया बड़ा एलान! | Modi Govt
द्वारा PunjabKesari TV| 887 दृश्य
Delhi:2 दिन बाद दूंगा CM पद से इस्तीफा,जनता की अदालत में साबित करुंगा अपनी ईमानदारी-Arvind Kejriwal
#delhi #arvindkejriwal #jantatv #cmarvindkejriwal #aamaadmiparty #aapnews #jantatv
Janta TV News Channel:
जनता टीवी हरियाणा, पंजाब और हिमाचल प्रदेश का सर्वश्रेष्ठ हिंदी न्यूज चैनल है। जनता टीवी न्यूज चैनल राजनीति, मनोरंजन, बॉलीवुड, व्यापार और खेल में नवीनतम समाचारों को शामिल करता है। जनता टीवी न्यूज चैनल की लाइव खबरें एवं ब्रेकिंग न्यूज के लिए बने रहें ।
जनता टीवी के साथ देखिये देश-प्रदेश की सभी महत्वपूर्ण और बड़ी खबरें|
Copyright Disclaimer Under Section 107 of the Copyright Act 1976, allowance is made for "fair use" for purposes such as criticism, comment, news reporting, teaching, scholarship, and research. Fair use is a use permitted by copyright statute that might otherwise be infringing. Non-profit, educational or personal use tips the balance in the favor of fair use.
#JantaTV
#Haryana
#HimachalPradesh
#Punjab
Watch the latest Hindi news Live on Janta TV
Janta TV is Best Hindi News Channel in Haryana, Punjab & Himachal. Janta TV news channel covers the latest news in Politics, Entertainment, Bollywood, Business and Sports.
Stay tuned for all the breaking news in Hindi!
Download Janta TV APP: On Android and IOS
https://play.google.com/store/apps/details?id=com.jantatv&hl=en
खबरों से अपडेट रहने के लिए जनता टीवी से जुड़िए-
Janta TV Telegram
https://t.me/+22_aahu6_44yZTJl
Janta TV Whatsapp
https://chat.whatsapp.com/BT4EgqJdcvsBMA7k1DEdwj
Subscribe to Janta TV YouTube Channel:
https://www.youtube.com/c/jantatvnews?sub_confirmation=1
https://www.youtube.com/c/JantaTVUttarPradeshUttrakhand?sub_confirmation=1
Visit Janta TV website:
https://www.jantatv.com/
Follow us on Facebook:
https://www.facebook.com/JantaTvNews
https://www.facebook.com/jantatvhimachal
https://www.facebook.com/JantaTvPunja
द्वारा Janta TV| 1011 दृश्य
महाराष्ट्र के इस गांव ने कैसे पानी का सही इस्तेमाल कर के सूखे से हरियाली तक का सफर तय किया.
#DWGlobalIdeas #Drought #Maharashtra
Get paid membership : https://www.youtube.com/channel/UCBbpLKJLhIbDd_wX4ubU_Cw/join
SUBSCRIBE TO OUR CHANNEL: https://www.youtube.com/channel/UCBbpLKJLhIbDd_wX4ubU_Cw
DESHBANDHU : http://www.deshbandhu.co.in/
FACEBOOK :https://www.facebook.com/deshbandhunew
TWITTER : https://twitter.com/dblive15
भारत में कैसे यह गांव बन गया सूखे से हरियाली की मिसाल #DWGlobalIdeas #Drought #Maharashtra #dblive
द्वारा DB Live| 799 दृश्य
#DelhiNCREarthquake #Earthquake #DelhiEarthquake #PunjabKesariTv
Subscribe to our YouTube channel: https://bit.ly/PunjabKesariTV
Also, Watch ►
Latest News & Updates ► https://bit.ly/PunjabKesariTVLatestNews
Latest News On Jammu & Kashmir ► https://bit.ly/JammuKashmirNews
Delhi News Updates | Punjab Kesari TV ► https://bit.ly/LatestDelhiNewsUpdates
Latest Updates On West Bengal ► https://bit.ly/LatestWestBengalNews
Viral Videos | Punjab Kesari TV ► https://bit.ly/LatestViralVideos
Punjab Kesari National | Latest News & Updates ► https://bit.ly/LatestNationalNews
Exclusive Interviews ► https://bit.ly/PunjabKesariTV-ExclusiveInterviews
Russia Ukraine Crisis Live Updates ► https://bit.ly/UkraineRussiaCrisisUpdates
Latest Updates On International News ► https://bit.ly/LatestInternationalNews
Follow us on Twitter: https://twitter.com/punjabkesari
Like us on FB: https://www.facebook.com/Pkesarionline/
Delhi-NCR में भूकंप के तेज झटके, मचा हड़कंप | Delhi NCR Earthquake LIVE Updates
द्वारा PunjabKesari TV| 989 दृश्य
Anil Vij ने CM पद के लिए ठोका दावा, कहा- मैं छह बार का विधायक हूं, पार्टी से आज तक कुछ नहीं मांगा
#anilvij #haryanacm #haryanapolitics #bjp #haryananews #anilvijnews #haryanaelection2024 #jantatv
Janta TV News Channel:
जनता टीवी हरियाणा, पंजाब और हिमाचल प्रदेश का सर्वश्रेष्ठ हिंदी न्यूज चैनल है। जनता टीवी न्यूज चैनल राजनीति, मनोरंजन, बॉलीवुड, व्यापार और खेल में नवीनतम समाचारों को शामिल करता है। जनता टीवी न्यूज चैनल की लाइव खबरें एवं ब्रेकिंग न्यूज के लिए बने रहें ।
जनता टीवी के साथ देखिये देश-प्रदेश की सभी महत्वपूर्ण और बड़ी खबरें|
Copyright Disclaimer Under Section 107 of the Copyright Act 1976, allowance is made for "fair use" for purposes such as criticism, comment, news reporting, teaching, scholarship, and research. Fair use is a use permitted by copyright statute that might otherwise be infringing. Non-profit, educational or personal use tips the balance in the favor of fair use.
#JantaTV
#Haryana
#HimachalPradesh
#Punjab
Watch the latest Hindi news Live on Janta TV
Janta TV is Best Hindi News Channel in Haryana, Punjab & Himachal. Janta TV news channel covers the latest news in Politics, Entertainment, Bollywood, Business and Sports.
Stay tuned for all the breaking news in Hindi!
Download Janta TV APP: On Android and IOS
https://play.google.com/store/apps/details?id=com.jantatv&hl=en
खबरों से अपडेट रहने के लिए जनता टीवी से जुड़िए-
Janta TV Telegram
https://t.me/+22_aahu6_44yZTJl
Janta TV Whatsapp
https://chat.whatsapp.com/BT4EgqJdcvsBMA7k1DEdwj
Subscribe to Janta TV YouTube Channel:
https://www.youtube.com/c/jantatvnews?sub_confirmation=1
https://www.youtube.com/c/JantaTVUttarPradeshUttrakhand?sub_confirmation=1
Visit Janta TV website:
https://www.jantatv.com/
Follow us on Facebook:
https://www.facebook.com/JantaTvNews
https://www.facebook.com/jantatvhimachal
https://www.facebook.com/
द्वारा Janta TV| 932 दृश्य