Yamla Pagla Deewana Phir Se | HONEST REVIEW | Dharmendra, Bobby Deol, Sunny Deol

Ad 30s Skip Ad in 5s -Skip Ad-
Visit advertiser site
  • Yamla Pagla Deewana Phir Se - Public Review - Dharmendra, Bobby Deol,Sunny Deol,Kriti Kharbanda

    Yamla Pagla Deewana Phir Se - Public Review - Dharmendra, Bobby Deol,Sunny Deol,Kriti Kharbanda

    Watch Yamla Pagla Deewana Phir Se - Public Review - Dharmendra, Bobby Deol,Sunny Deol,Kriti Kharbanda With HD Quality

    By BOLLYWOOD FLASH| 2532 views

  • Yamla Pagla Deewana Phir Se REVIEW By Expert Amarpreet Singh | Dharmendra, Bobby Deol, Sunny Deol

    Yamla Pagla Deewana Phir Se REVIEW By Expert Amarpreet Singh | Dharmendra, Bobby Deol, Sunny Deol

    Yamla Pagla Deewana Phir Se REVIEW By Expert Amarpreet Singh | Dharmendra, Bobby Deol, Sunny Deol #BollywoodSpy #BollywoodNews #BollywoodGossips - Stay Tuned For More Bollywood News

    Check All Bollywood Latest Update on our Channel

    Subscribe to our Channel https://goo.gl/UerBDn

    Like us on Facebook https://goo.gl/7Q896J

    Follow us on Twitter https://goo.gl/AjQfa4

    Circle us on G+ https://goo.gl/57XqjC

    Follow us on Instagram https://goo.gl/x48yEy

    Watch Yamla Pagla Deewana Phir Se REVIEW By Expert Amarpreet Singh | Dharmendra, Bobby Deol, Sunny Deol With HD Quality

    By Bollywood Spy| 228 views

  • Yamla Pagla Deewana Phir Se PUBLIC REVIEW | Second Show | Dharmendra, Bobby Deol, Sunny Deol

    Yamla Pagla Deewana Phir Se PUBLIC REVIEW | Second Show | Dharmendra, Bobby Deol, Sunny Deol

    Yamla Pagla Deewana Phir Se PUBLIC REVIEW | Second Show | Dharmendra, Bobby Deol, Sunny Deol #BollywoodSpy #BollywoodNews #BollywoodGossips - Stay Tuned For More Bollywood News

    Check All Bollywood Latest Update on our Channel

    Subscribe to our Channel https://goo.gl/UerBDn

    Like us on Facebook https://goo.gl/7Q896J

    Follow us on Twitter https://goo.gl/AjQfa4

    Circle us on G+ https://goo.gl/57XqjC

    Follow us on Instagram https://goo.gl/x48yEy

    Watch Yamla Pagla Deewana Phir Se PUBLIC REVIEW | Second Show | Dharmendra, Bobby Deol, Sunny Deol With HD Quality

    By Bollywood Spy| 841 views

  • 'Yamla Pagla Deewana: Phir Se' | Public Review | Sunny Deol, Bobby Deol, Dharmendra

    'Yamla Pagla Deewana: Phir Se' | Public Review | Sunny Deol, Bobby Deol, Dharmendra

    Sunny Deol, Bobby Deol, Dharmendra - starrer 'Yamla Pagla Deewana: Phir Se' has hit the screens today, and here's what moviegoers have to say about the film.

    Check out the video to know more

    SUBSCRIBE To Bollywood Bubble:
    Click Here ► http://bit.ly/2hjMB6X

    Tune into Bollywood Bubble, your one stop destination for all the latest happenings, hot gossips, rumours and exclusive B-Town news...

    Also, Visit - https://www.bollywoodbubble.com . One stop Destination for Latest Bollywood Updates.

    Like us on Facebook - https://www.facebook.com/BollywoodBubble

    Follow us on Twitter - https://twitter.com/bollybubble

    Follow us on Instagram - www.instagram.com/bollywoodbubble

    Click On the Subscribe Button NOW and Stay Tuned.Watch 'Yamla Pagla Deewana: Phir Se' | Public Review | Sunny Deol, Bobby Deol, Dharmendra With HD Quality

    By Bollywood Bubble| 2901 views

  • Yamla Pagla Deewana Phir Se | Public Review | Dharmendra | Sunny Deol | Bobby Deol |Dainik Savera

    Yamla Pagla Deewana Phir Se | Public Review | Dharmendra | Sunny Deol | Bobby Deol |Dainik Savera

    Yamla Pagla Deewana Phir Se | Public Review | Dharmendra | Sunny Deol | Bobby Deol | Dainik Savera


    Watch Yamla Pagla Deewana Phir Se | Public Review | Dharmendra | Sunny Deol | Bobby Deol |Dainik Savera With HD Quality

    By Savera Star Talks| 1031 views

  • Yamla Pagla Deewana Phir Se | FIRST LOOK Out | Bobby Deol, Dharmendra, Sunny Deol

    Yamla Pagla Deewana Phir Se | FIRST LOOK Out | Bobby Deol, Dharmendra, Sunny Deol

    Yamla Pagla Deewana Phir Se | FIRST LOOK Out | Bobby Deol, Dharmendra, Sunny Deol

    - Stay Tuned For More Bollywood News

    Check All Bollywood Latest Update on our Channel

    Subscribe to our Channel https://goo.gl/UerBDn

    Like us on Facebook https://goo.gl/7Q896J

    Follow us on Twitter https://goo.gl/AjQfa4

    Circle us on G+ https://goo.gl/57XqjC

    Follow us on Instagram https://goo.gl/x48yEy


    Watch Yamla Pagla Deewana Phir Se | FIRST LOOK Out | Bobby Deol, Dharmendra, Sunny Deol With HD Quality

    By Bollywood Spy| 13996 views

  • Yamla Pagla Deewana Phir Se TEASER OUT | Dharmendra, Sunny Deol, Bobby Deol, Salman Khan

    Yamla Pagla Deewana Phir Se TEASER OUT | Dharmendra, Sunny Deol, Bobby Deol, Salman Khan

    Yamla Pagla Deewana Phir Se TEASER OUT | Dharmendra, Sunny Deol, Bobby Deol, Salman Khan - Stay Tuned For More Bollywood News

    Check All Bollywood Latest Update on our Channel

    Subscribe to our Channel https://goo.gl/UerBDn

    Like us on Facebook https://goo.gl/7Q896J

    Follow us on Twitter https://goo.gl/AjQfa4

    Circle us on G+ https://goo.gl/57XqjC

    Follow us on Instagram https://goo.gl/x48yEy


    Watch Yamla Pagla Deewana Phir Se TEASER OUT | Dharmendra, Sunny Deol, Bobby Deol, Salman Khan With HD Quality

    By Bollywood Spy| 489 views

  • Yamla Pagla Deewana Phir Se | Official Teaser | Dharmendra | Sunny Deol | Salman Khan | Bobby Deol

    Yamla Pagla Deewana Phir Se | Official Teaser | Dharmendra | Sunny Deol | Salman Khan | Bobby Deol

    Yamla Pagla Deewana Phir Se

    Directed by: Navaniat Singh

    Produced by: Kamayani Punia Sharma, Aarushi Malhotra
    Cast: Dharmendra, Sunny Deol, Bobby Deol, Kriti Kharbanda, Asrani, Satish Kaushik, Binnu Dhillon

    Singers: Harrdy Sandhu, Sachet Tandon, Alam, Shahid Mallya, Jyotika Tangri

    Choreographers: Remo D'souza, Adil Shaikh, Rajeev Surti

    Action Director: Vikram Dahiya (Bunty)

    Editor: Manish More

    Production Designer: Rita Ghosh

    Background Score: Raju Singh

    Executive Producer: Rupesh Mali

    Associate Director: Rahul Maniktala

    Sound Designers: Parikshit Lalwani & Kunal Mehta

    RELEASING ON 15th AUGUST
    For More Latest News Update Do Not Forget To Subscribe

    Watch Yamla Pagla Deewana Phir Se | Official Teaser | Dharmendra | Sunny Deol | Salman Khan | Bobby Deol With HD Quality

    By Delhi Darpan TV| 1496 views

  • Yamla Pagla Deewana Phir Se TRAILER OUT | Salman Khan, Dharmendra, Sunny Deol, Bobby Deol

    Yamla Pagla Deewana Phir Se TRAILER OUT | Salman Khan, Dharmendra, Sunny Deol, Bobby Deol

    Yamla Pagla Deewana Phir Se TRAILER OUT | Salman Khan, Dharmendra, Sunny Deol, Bobby Deol #BollywoodSpy #BollywoodNews #BollywoodGossips - Stay Tuned For More Bollywood News

    Check All Bollywood Latest Update on our Channel

    Subscribe to our Channel https://goo.gl/UerBDn

    Like us on Facebook https://goo.gl/7Q896J

    Follow us on Twitter https://goo.gl/AjQfa4

    Circle us on G+ https://goo.gl/57XqjC

    Follow us on Instagram https://goo.gl/x48yEy

    Watch Yamla Pagla Deewana Phir Se TRAILER OUT | Salman Khan, Dharmendra, Sunny Deol, Bobby Deol With HD Quality

    By Bollywood Spy| 497 views

Replay
Bollywood Spy's image
Published on: Aug 31, 2018

Yamla Pagla Deewana Phir Se | HONEST REVIEW | Dharmendra, Bobby Deol, Sunny Deol #BollywoodSpy #BollywoodNews #BollywoodGossips - Stay Tuned For More Bollywood News

Check All Bollywood Latest Update on our Channel

Subscribe to our Channel https://goo.gl/UerBDn

Like us on Facebook https://goo.gl/7Q896J

Follow us on Twitter https://goo.gl/AjQfa4

Circle us on G+ https://goo.gl/57XqjC

Follow us on Instagram https://goo.gl/x48yEy

Watch Yamla Pagla Deewana Phir Se | HONEST REVIEW | Dharmendra, Bobby Deol, Sunny Deol With HD Quality

#SalmanKhan#screening#sunnydeol#Dharmendra#ComedyMovie#bobbydeol#YamlaPaglaDeewanaPhirSetrailer#YamlaPaglaDeewanaPhirSetrailerlaunch#yamlapagladeewanaphirsetrailersongs#yamlapagladeewanaphirsefulltrailer#yamlapagladeewanaphirseofficialtrailer#yamlapagladeewanaphirsesong#yamlapagladeewanaphirseallvideosongs#dharmendrayamlapagladeewanamovie#YamlaPaglaDeewanaPhirSepublicreview#krtitikharbanda#raftarafta


Category:

Entertainment

Show More [+]
Show Less [-]
Size : x pixels
0 comments founds
No comments received yet, Be first to add comment.
Autoplay
  • Yamla Pagla Deewana Phir Se - Public Review - Dharmendra, Bobby Deol,Sunny Deol,Kriti KharbandaUp next

    Yamla Pagla Deewana Phir Se - Public Review - Dharmendra, Bobby Deol,Sunny Deol,Kriti Kharbanda

    Watch Yamla Pagla Deewana Phir Se - Public Review - Dharmendra, Bobby Deol,Sunny Deol,Kriti Kharbanda With HD Quality

    By BOLLYWOOD FLASH| 2532 views

  • Yamla Pagla Deewana Phir Se REVIEW By Expert Amarpreet Singh | Dharmendra, Bobby Deol, Sunny Deol

    Yamla Pagla Deewana Phir Se REVIEW By Expert Amarpreet Singh | Dharmendra, Bobby Deol, Sunny Deol

    Yamla Pagla Deewana Phir Se REVIEW By Expert Amarpreet Singh | Dharmendra, Bobby Deol, Sunny Deol #BollywoodSpy #BollywoodNews #BollywoodGossips - Stay Tuned For More Bollywood News

    Check All Bollywood Latest Update on our Channel

    Subscribe to our Channel https://goo.gl/UerBDn

    Like us on Facebook https://goo.gl/7Q896J

    Follow us on Twitter https://goo.gl/AjQfa4

    Circle us on G+ https://goo.gl/57XqjC

    Follow us on Instagram https://goo.gl/x48yEy

    Watch Yamla Pagla Deewana Phir Se REVIEW By Expert Amarpreet Singh | Dharmendra, Bobby Deol, Sunny Deol With HD Quality

    By Bollywood Spy| 228 views

  • Yamla Pagla Deewana Phir Se PUBLIC REVIEW | Second Show | Dharmendra, Bobby Deol, Sunny Deol

    Yamla Pagla Deewana Phir Se PUBLIC REVIEW | Second Show | Dharmendra, Bobby Deol, Sunny Deol

    Yamla Pagla Deewana Phir Se PUBLIC REVIEW | Second Show | Dharmendra, Bobby Deol, Sunny Deol #BollywoodSpy #BollywoodNews #BollywoodGossips - Stay Tuned For More Bollywood News

    Check All Bollywood Latest Update on our Channel

    Subscribe to our Channel https://goo.gl/UerBDn

    Like us on Facebook https://goo.gl/7Q896J

    Follow us on Twitter https://goo.gl/AjQfa4

    Circle us on G+ https://goo.gl/57XqjC

    Follow us on Instagram https://goo.gl/x48yEy

    Watch Yamla Pagla Deewana Phir Se PUBLIC REVIEW | Second Show | Dharmendra, Bobby Deol, Sunny Deol With HD Quality

    By Bollywood Spy| 841 views

  • 'Yamla Pagla Deewana: Phir Se' | Public Review | Sunny Deol, Bobby Deol, Dharmendra

    'Yamla Pagla Deewana: Phir Se' | Public Review | Sunny Deol, Bobby Deol, Dharmendra

    Sunny Deol, Bobby Deol, Dharmendra - starrer 'Yamla Pagla Deewana: Phir Se' has hit the screens today, and here's what moviegoers have to say about the film.

    Check out the video to know more

    SUBSCRIBE To Bollywood Bubble:
    Click Here ► http://bit.ly/2hjMB6X

    Tune into Bollywood Bubble, your one stop destination for all the latest happenings, hot gossips, rumours and exclusive B-Town news...

    Also, Visit - https://www.bollywoodbubble.com . One stop Destination for Latest Bollywood Updates.

    Like us on Facebook - https://www.facebook.com/BollywoodBubble

    Follow us on Twitter - https://twitter.com/bollybubble

    Follow us on Instagram - www.instagram.com/bollywoodbubble

    Click On the Subscribe Button NOW and Stay Tuned.Watch 'Yamla Pagla Deewana: Phir Se' | Public Review | Sunny Deol, Bobby Deol, Dharmendra With HD Quality

    By Bollywood Bubble| 2901 views

  • Yamla Pagla Deewana Phir Se | Public Review | Dharmendra | Sunny Deol | Bobby Deol |Dainik Savera

    Yamla Pagla Deewana Phir Se | Public Review | Dharmendra | Sunny Deol | Bobby Deol |Dainik Savera

    Yamla Pagla Deewana Phir Se | Public Review | Dharmendra | Sunny Deol | Bobby Deol | Dainik Savera


    Watch Yamla Pagla Deewana Phir Se | Public Review | Dharmendra | Sunny Deol | Bobby Deol |Dainik Savera With HD Quality

    By Savera Star Talks| 1031 views

  • Yamla Pagla Deewana Phir Se | FIRST LOOK Out | Bobby Deol, Dharmendra, Sunny Deol

    Yamla Pagla Deewana Phir Se | FIRST LOOK Out | Bobby Deol, Dharmendra, Sunny Deol

    Yamla Pagla Deewana Phir Se | FIRST LOOK Out | Bobby Deol, Dharmendra, Sunny Deol

    - Stay Tuned For More Bollywood News

    Check All Bollywood Latest Update on our Channel

    Subscribe to our Channel https://goo.gl/UerBDn

    Like us on Facebook https://goo.gl/7Q896J

    Follow us on Twitter https://goo.gl/AjQfa4

    Circle us on G+ https://goo.gl/57XqjC

    Follow us on Instagram https://goo.gl/x48yEy


    Watch Yamla Pagla Deewana Phir Se | FIRST LOOK Out | Bobby Deol, Dharmendra, Sunny Deol With HD Quality

    By Bollywood Spy| 13996 views

  • Yamla Pagla Deewana Phir Se TEASER OUT | Dharmendra, Sunny Deol, Bobby Deol, Salman Khan

    Yamla Pagla Deewana Phir Se TEASER OUT | Dharmendra, Sunny Deol, Bobby Deol, Salman Khan

    Yamla Pagla Deewana Phir Se TEASER OUT | Dharmendra, Sunny Deol, Bobby Deol, Salman Khan - Stay Tuned For More Bollywood News

    Check All Bollywood Latest Update on our Channel

    Subscribe to our Channel https://goo.gl/UerBDn

    Like us on Facebook https://goo.gl/7Q896J

    Follow us on Twitter https://goo.gl/AjQfa4

    Circle us on G+ https://goo.gl/57XqjC

    Follow us on Instagram https://goo.gl/x48yEy


    Watch Yamla Pagla Deewana Phir Se TEASER OUT | Dharmendra, Sunny Deol, Bobby Deol, Salman Khan With HD Quality

    By Bollywood Spy| 489 views

  • Yamla Pagla Deewana Phir Se | Official Teaser | Dharmendra | Sunny Deol | Salman Khan | Bobby Deol

    Yamla Pagla Deewana Phir Se | Official Teaser | Dharmendra | Sunny Deol | Salman Khan | Bobby Deol

    Yamla Pagla Deewana Phir Se

    Directed by: Navaniat Singh

    Produced by: Kamayani Punia Sharma, Aarushi Malhotra
    Cast: Dharmendra, Sunny Deol, Bobby Deol, Kriti Kharbanda, Asrani, Satish Kaushik, Binnu Dhillon

    Singers: Harrdy Sandhu, Sachet Tandon, Alam, Shahid Mallya, Jyotika Tangri

    Choreographers: Remo D'souza, Adil Shaikh, Rajeev Surti

    Action Director: Vikram Dahiya (Bunty)

    Editor: Manish More

    Production Designer: Rita Ghosh

    Background Score: Raju Singh

    Executive Producer: Rupesh Mali

    Associate Director: Rahul Maniktala

    Sound Designers: Parikshit Lalwani & Kunal Mehta

    RELEASING ON 15th AUGUST
    For More Latest News Update Do Not Forget To Subscribe

    Watch Yamla Pagla Deewana Phir Se | Official Teaser | Dharmendra | Sunny Deol | Salman Khan | Bobby Deol With HD Quality

    By Delhi Darpan TV| 1496 views

  • Yamla Pagla Deewana Phir Se TRAILER OUT | Salman Khan, Dharmendra, Sunny Deol, Bobby Deol

    Yamla Pagla Deewana Phir Se TRAILER OUT | Salman Khan, Dharmendra, Sunny Deol, Bobby Deol

    Yamla Pagla Deewana Phir Se TRAILER OUT | Salman Khan, Dharmendra, Sunny Deol, Bobby Deol #BollywoodSpy #BollywoodNews #BollywoodGossips - Stay Tuned For More Bollywood News

    Check All Bollywood Latest Update on our Channel

    Subscribe to our Channel https://goo.gl/UerBDn

    Like us on Facebook https://goo.gl/7Q896J

    Follow us on Twitter https://goo.gl/AjQfa4

    Circle us on G+ https://goo.gl/57XqjC

    Follow us on Instagram https://goo.gl/x48yEy

    Watch Yamla Pagla Deewana Phir Se TRAILER OUT | Salman Khan, Dharmendra, Sunny Deol, Bobby Deol With HD Quality

    By Bollywood Spy| 497 views

Bollywood Spy

  • Bigg Boss 13 | Asim Riaz Vs Sidharth Fan On DHAKKA | Bigg Charcha | BB 13 Video

    Bigg Boss 13 | Asim Riaz Vs Sidharth Fan On DHAKKA | Bigg Charcha | BB 13 Video

    Bigg Boss 13 | Asim Riaz Vs Sidharth Fan On DHAKKA | Bigg Charcha | BB 13 Video

    #biggboss13 #bb13- Stay Tuned For More Bollywood News

    ☞ Check All Bollywood Latest Update on our Channel

    ☞ Subscribe to our Channel https://goo.gl/UerBDn

    ☞ Like us on Facebook https://goo.gl/7Q896J

    ☞ Follow us on Twitter https://goo.gl/AjQfa4

    ☞ Circle us on G+ https://goo.gl/57XqjC

    ☞ Follow us on Instagram https://goo.gl/x48yEy

    Watch Bigg Boss 13 | Asim Riaz Vs Sidharth Fan On DHAKKA | Bigg Charcha | BB 13 Video With HD Quality

    By Bollywood Spy| 112 views

  • Bigg Boss 13 | ASIM VS WHOLE HOUSE | Rashmi May Join Sidharth | BB 13 Video

    Bigg Boss 13 | ASIM VS WHOLE HOUSE | Rashmi May Join Sidharth | BB 13 Video

    Bigg Boss 13 | ASIM VS WHOLE HOUSE | Rashmi May Join Sidharth | BB 13 Video

    #biggboss13 #bb13 - Stay Tuned For More Bollywood News

    ☞ Check All Bollywood Latest Update on our Channel

    ☞ Subscribe to our Channel https://goo.gl/UerBDn

    ☞ Like us on Facebook https://goo.gl/7Q896J

    ☞ Follow us on Twitter https://goo.gl/AjQfa4

    ☞ Circle us on G+ https://goo.gl/57XqjC

    ☞ Follow us on Instagram https://goo.gl/x48yEy

    Watch Bigg Boss 13 | ASIM VS WHOLE HOUSE | Rashmi May Join Sidharth | BB 13 Video With HD Quality

    By Bollywood Spy| 107 views

  • Urvashi Rautela DHAMAKEDAR Rapid Fire | Salman Khan As Bodybuilder, Shahrukh Khan As Acting Tutor

    Urvashi Rautela DHAMAKEDAR Rapid Fire | Salman Khan As Bodybuilder, Shahrukh Khan As Acting Tutor

    Urvashi Rautela DHAMAKEDAR Rapid Fire | Salman Khan As Bodybuilder, Shahrukh Khan As Acting Tutor
    #urvashirautela - Stay Tuned For More Bollywood News

    ☞ Check All Bollywood Latest Update on our Channel

    ☞ Subscribe to our Channel https://goo.gl/UerBDn

    ☞ Like us on Facebook https://goo.gl/7Q896J

    ☞ Follow us on Twitter https://goo.gl/AjQfa4

    ☞ Circle us on G+ https://goo.gl/57XqjC

    ☞ Follow us on Instagram https://goo.gl/x48yEyWatch Urvashi Rautela DHAMAKEDAR Rapid Fire | Salman Khan As Bodybuilder, Shahrukh Khan As Acting Tutor With HD Quality

    By Bollywood Spy| 72 views

Fashion

  • My Night Skin Care routine 2020

    My Night Skin Care routine 2020

    #sinhala #beautywithsumu #srilankanbeautytherapist #spaceylon #nightskincareroutine #glassskin
    #skinlightening #oilyskintreatment #oilyskincare

    Hey Beauties
    As you requested i thought to make a review of my current night skin care routine.for more detail please keep watching ????????
    I hope you will like this video and Don't forget to hit the SUBSCRIBE button.

    Product i used
    step 1 Double Cleansing
    WHITE MINT - Facial Cleansing Foam (RS:3100)
    https://bit.ly/30uQhGY

    step 2 Exfoliating
    NEEM & TEA TREE - Refining Natural Exfoliator (RS:3900)
    https://bit.ly/30tgjKz

    step 3 Toning (RS:3200)
    WHITE MINT – Facial Skin Tonic
    https://bit.ly/30rQnPp

    step 4 Facial Masque (RS:3250)
    NEEM & TEA TREE - Overnight Treatment Masque
    https://bit.ly/2TpAIPa

    Spa Ceylon in Social media
    Official Site : https://lk.spaceylon.com/
    Facebook https://www.facebook.com/SpaCeylonAyu...
    Instagram https://www.instagram.com/spaceylonof...

    already done about eye cream and lip balm so please check out them
    Lip Balm https://bit.ly/2RqmTxe
    Eye Cream https://bit.ly/2R1JoK9

    facebook https://www.facebook.com/beautywithsumu/
    instagram https://www.instagram.com/beautywiths...
    email beautywithsumu@gmail.com

    Watch My Night Skin Care routine 2020 With HD Quality

    By Beauty with Sumu| 18052 views

  • Secret to Flawless Younger Skin | Ageless Serum with Hyaluronic acid | Simple Skincare for Winters

    Secret to Flawless Younger Skin | Ageless Serum with Hyaluronic acid | Simple Skincare for Winters

    hey Guys,

    Today we are talking about face serums and everything you need to know about them.
    We will see how and why Face Serums are more effective than moisturizers and and how to use and apply face serum on everyday basis to see results quickly.

    I have been using Mama Earth Skin Plump Face serum which is best for fine lines and aging skin.
    and have seen tremendous difference in my skin. Its really good.

    You can buy it here -
    Website: http://bit.ly/2ZmglDB (Use code nidhi2020 for 20% off at mamaearth.in)

    Amazon:https://amzn.to/2EUfNeA

    Nykaa: http://bit.ly/34XmmYg

    Follow me on all my social media's below:
    email :prettysimplenk@gmail.com
    Facebook: https://www.facebook.com/prettysimplenk/
    Twitter : https://twitter.com/prettysimplenk
    Instagram - https://www.instagram.com/nidhi.167/

    This Video is Sponsored by Mama Earth.

    how to apply face serum,how to apply face serum in hindi,applying face serum,apply face serum hindi,face serum tutorial,face serum tutorial hindi,how to use face serum,face serum at home,face serum for makeup,face serum,face serum hindi,what are face serums, how to use face serum, which is the best face serum, face serum for fine lines, face serum for acne marks, niacinamide face serums, hyaluronic acid face serum

    Watch Secret to Flawless Younger Skin | Ageless Serum with Hyaluronic acid | Simple Skincare for Winters With HD Quality

    By Nidhi Katiyar| 11848 views

  • Beautiful Hairstyle For Party/Wedding 2019 | Easy Hairstyles For Long Hair

    Beautiful Hairstyle For Party/Wedding 2019 | Easy Hairstyles For Long Hair

    Please subscribe & share for more videos:
    Subscribe: https://goo.gl/cWHPBJ

    Beautiful Hairstyle For Party/Wedding 2019 | Easy Hairstyles For Long Hair


    Watch Beautiful Hairstyle For Party/Wedding 2019 | Easy Hairstyles For Long Hair With HD Quality

    By Saheli Tutorials| 19810 views

  • What's New in Affordable ? | Trying out new Affordable Makeup | Swiss beauty Las Vegas Palette

    What's New in Affordable ? | Trying out new Affordable Makeup | Swiss beauty Las Vegas Palette

    Hey guys, Today I am going to try out some new affordable makeup.
    Especially the newly launched, Swiss Beauty Las Vegas Eyeshadow Plus Cheek Palette and Maliao Eyeliner + Mascara.


    5. Maliao Lip Palette - Rs. 199
    https://www.cuffsnlashes.com/maliao-sealed-with-a-kiss-lip-palette

    6. 20 Something Makeup Fixer - Rs. 125
    https://www.cuffsnlashes.com/20-something-makeup-fixer35ml-aloe-vera-with-vitamin-e


    whats new in affordable,affordable makeup,nidhi katiyar,makeup try on haul,swiss beauty las vegas palette review,swiss beauty las vegas,swiss beauty,affordable makeup try on,sfr concealer palette review,sfr color,Maliao lip Palette,maliao mascara review,maliao mascara,maliao,maliao eyeliner waterproof,maliao eyeliner review,maliao eyeliner price,maliao double effect mascara and eyeliner,maliao review,affordable makeup india,nidhi katiyar makeup

    By Nidhi Katiyar| 16167 views

  • My Favourite Skincare Products of 2019 | JSuper Kaur

    My Favourite Skincare Products of 2019 | JSuper Kaur

    My Best Skin Care Product of 2019


    *************************************************************************************************************
    Product Links :
    1.Merit Vco Extra Virgin Coconut Oil : https://amzn.to/36YKw6R
    2. Mamaearth Bye Bye Blemishes : https://amzn.to/388xuUr
    3. Kama Ayurveda Kumkumadi : https://amzn.to/2FTCSPh
    4. Plum Green Tea : https://amzn.to/3aeHnBR
    5. Kiehl's Turmeric & Cranberry Seed : https://amzn.to/38661Tc
    6. Tinkle Eyebrow Shaper : https://amzn.to/2Nxnr3d
    7. The Face Shop Aloe Fresh Soothing Moisture Gel : https://amzn.to/2R0pFu0
    8. Kama Ayurveda Pure Rose : https://amzn.to/2TtcvHN

    **************************************************************************************************************

    Camera Used : https://amzn.to/318ppMI
    Vlog Camera : https://amzn.to/2QLo5e3
    Shooting Lights : https://amzn.to/2ETZ5fL
    Ring Light : https://amzn.to/31ldcVc
    Tripod Used : https://amzn.to/2WMVA4W
    My Fav Lipstick Colour : https://amzn.to/2WQz7E4
    : https://amzn.to/2WHV9sR
    : https://amzn.to/2QNDzOF
    : https://amzn.to/2Kr07n6
    ***********************************************************************

    For Make & Beauty Tips Subscribe to my other channel
    Super Beauty : https://www.youtube.com/channel/UCG2yeNDaXoJCjtUNlZi15Dw

    Follow me on all social media & be my Friend! Please do Like, Subscribe & Share :-
    * YouTube : http://www.youtube.com/c/JSuperkaurbeauty
    * Facebook : https://www.facebook.com/JSuper.Kaur
    * Instagram : https://www.instagram.com/jsuper.kaur
    * Twitter : https://twitter.com/JsuperKaur
    * Google+ : https://plus.google.com/+JSuperkaur
    * Website : www.jsuperkaur.com


    For Business Inquiries -
    E-Mail : jsuperkaur@gmail.com
    <

    By JSuper kaur| 14420 views

  • How to make a (tasty) Vegetable Salad (Recipe)| Hindi Cooking Video|

    How to make a (tasty) Vegetable Salad (Recipe)| Hindi Cooking Video|

    Hey guys! In this video I've shared how I make my vegetable salad really tasty and healthy at the same time. This is what works as per my diet and exercise routine. You can tweak the ingredients as per your taste and what works for your diet. I like to have a protein rich vegetarian diet which is low on carbs. At the moment, I've been gluten free for over a month and would love to share more on the same on my Instagram or in a youtube video. Please do let me know in the comments if you'd be interested to see more vegetarian recipe videos.
    Lots of love.

    Music: Ice Cream,Youtube Audio Library.

    Follow me on my social media:

    Facebook: https://www.facebook.com/nehadesai21
    Instagram: https://www.instagram.com/nehadesai.blog
    Twitter: https://twitter.com/neaadesai
    Snapchat: https://www.snapchat.com/add/neaa2106
    Digitally Powered by One Digital Entertainment [https://www.facebook.com/OneDigitalEntertainment]
    [Website - http://www.onedigitalentertainment.com]Watch How to make a (tasty) Vegetable Salad (Recipe)| Hindi Cooking Video| With HD Quality

    By Neha Desai| 13553 views

Recommended

  • #WalkWithKejriwal | AAP National Convenor Arvind Kejriwal's Nomination Roadshow

    #WalkWithKejriwal | AAP National Convenor Arvind Kejriwal's Nomination Roadshow

    #WalkWithKejriwal | AAP National Convenor Arvind Kejriwal's Nomination Roadshow
    __________________________________________________________________________________
    The New Arvind Kejriwal App Launched | Download AK App from https://play.google.com/store/apps/details?id=com.arvindkejriwalapp

    Watch Other Speeches of Arvind Kejriwal
    1. Arvind Kejriwal on Delhi Water Crisis: https://bit.ly/2O8DsQ7
    2. Arvind Kejriwal ने बताया क्यों ज़रूरी है स्कूल में CCTV कैमरे लगवाना https://bit.ly/32BtKIZ
    3. Arvind Kejriwal on the inauguration of India’s largest Water Sewage Treatment Plant (STP) : https://bit.ly/2LxxfuF
    4. Arvind Kejriwal on Education System in India: https://bit.ly/2XQEmoN
    Follow Arvind Kejriwal on Twitter: https://www.twitter.com/ArvindKejriwal
    Follow Arvind Kejriwal on Facebook: https://www.facebook.com/AAPkaArvind/
    Follow Aam Aadmi Party on Facebook: https://www.facebook.com/AamAadmiParty
    Follow Aam Aadmi Party on Twitter: https://www.twitter.com/AamAadmiParty

    Watch #WalkWithKejriwal | AAP National Convenor Arvind Kejriwal's Nomination Roadshow With HD Quality

    By AAP| 13478 views

  • आज देश में जो बेरोजगारी की स्थिति है उससे युवाओं के मन में डर का महौल है: राहुल गांधी

    आज देश में जो बेरोजगारी की स्थिति है उससे युवाओं के मन में डर का महौल है: राहुल गांधी

    आज देश में जो बेरोजगारी की स्थिति है उससे युवाओं के मन में डर का महौल है: राहुल गांधी

    Declaration:
    This video is an intellectual property belonging to the Indian National Congress. Please seek prior permission before using any part of this video in any form.


    For more videos, subscribe to Congress Party channel: https://www.youtube.com/user/indiacongress


    Follow Indian National Congress!

    Follow the Indian National Congress on
    Facebook: https://www.facebook.com/IndianNationalCongress
    Twitter:https://twitter.com/INCIndia
    Instagram: https://www.instagram.com/incindia/
    YouTube: https://www.youtube.com/user/indiacongress

    Follow Rahul Gandhi on

    YouTube: https://www.youtube.com/c/rahulgandhi/
    Facebook: https://www.facebook.com/rahulgandhi/
    Twitter: https://twitter.com/rahulgandhi/
    Instagram: https://www.instagram.com/rahulgandhi/

    Watch आज देश में जो बेरोजगारी की स्थिति है उससे युवाओं के मन में डर का महौल है: राहुल गांधी With HD Quality

    By Indian National Congress| 10028 views

  • Zomato acquires UberEats India in all-stock deal, first big consolidation in food delivery space

    Zomato acquires UberEats India in all-stock deal, first big consolidation in food delivery space

    Zomato on Tuesday announced that it has acquired Uber's Food Delivery Business in India in an all-stock deal and Uber will have 9.99 per cent stake in the Deepinder Goyal-led food delivery platform. According to sources close to the deal, it is in the range of over $350 million or nearly Rs 2,500 crore. Uber Eats in India will discontinue operations and direct restaurants, delivery partners, and users of the Uber Eats apps to the Zomato platform, effective from Tuesday.

    ► Subscribe to The Economic Times for latest video updates. It's free! - http://www.youtube.com/TheEconomicTimes?sub_confirmation=1

    ► More Videos @ ETTV - http://economictimes.indiatimes.com/TV

    ► http://EconomicTimes.com

    ► For business news on the go, download ET app:
    https://etapp.onelink.me/tOvY/EconomicTimesApp

    Follow ET on:

    ► Facebook - https://www.facebook.com/EconomicTimes
    ► Twitter - http://www.twitter.com/economictimes
    ► LinkedIn - http://www.linkedin.com/company/economictimes
    ► Instagram - https://www.instagram.com/the_economic_times
    ► Flipboard - https://flipboard.com/@economictimes

    The Economic Times | A Times Internet Limited product

    Watch Zomato acquires UberEats India in all-stock deal, first big consolidation in food delivery space With HD Quality

    By The Economic Times| 139 views

  • 'हलवा रस्म' के साथ आज से बजट की छपाई शुरू

    'हलवा रस्म' के साथ आज से बजट की छपाई शुरू

    'हलवा रस्म' के साथ आज से बजट की छपाई शुरू

    Watch 'हलवा रस्म' के साथ आज से बजट की छपाई शुरू With HD Quality

    By NewsFirst.TV| 12714 views

  • India ने लॉन्च की K-4 Ballistic Missile, खूबियां के चलते K-4 बना Black Project

    India ने लॉन्च की K-4 Ballistic Missile, खूबियां के चलते K-4 बना Black Project

    India ने रविवार को Andhra Pradesh के तट से K-4 Ballistic Missile का सफल टेस्ट किया। हालाँकि इस टेस्ट की आधिकारिक घोषणा न तो Defence Ministry ने की है और न ही Defence Research And Development Organisation रिसर्च एंड डेवलपमेंट आर्गेनाईजेशन ( डीआरडीओ) ने। इसकी घोषणा इसलिए नहीं हुई क्योंकि इसका निर्माण DRDO ने जिस प्रोजेक्ट के तहत किया है उसका नाम Black Project है क्योंकि अति संवेदनशील जानकारी होने के चलते इस प्रोजेक्ट में काफी गोपनीयता बरती गई है । K-4 एक सब मरीन लॉन्चड बैलिस्टिक मिसाइल (SLBM) है जिसे समुन्द्र की गहराईओं में पनडुब्बी से लॉन्च किया जा सकता है। जिस अरिहंत पनडुब्बी से K-4 को लॉन्च किया गया वो भारत की पहली स्वदेशी परमाणु पनडुब्बी है। K-4 का नाम भारत के मिसाइल मैन और दिवंगत पूर्व राष्ट्रपति डॉक्टर APJ अब्दुल कलाम के नाम पर रखा गया है, K का मतलब है कलाम।

    To Subscribe on Youtube: 

    https://www.youtube.com/user/punjabkesaritv

    Follow us on Twitter :
    https://twitter.com/punjabkesari

    Like us on FB:
     https://www.facebook.com/Pkesarionline/

    Watch India ने लॉन्च की K-4 Ballistic Missile, खूबियां के चलते K-4 बना Black Project With HD Quality

    By PunjabKesari TV| 56 views