Yamla Pagla Deewana Phir Se | HONEST REVIEW | Dharmendra, Bobby Deol, Sunny Deol
Yamla Pagla Deewana Phir Se - Public Review - Dharmendra, Bobby Deol,Sunny Deol,Kriti Kharbanda
Watch Yamla Pagla Deewana Phir Se - Public Review - Dharmendra, Bobby Deol,Sunny Deol,Kriti Kharbanda With HD Quality
By BOLLYWOOD FLASH| 2532 views
Yamla Pagla Deewana Phir Se REVIEW By Expert Amarpreet Singh | Dharmendra, Bobby Deol, Sunny Deol
Yamla Pagla Deewana Phir Se REVIEW By Expert Amarpreet Singh | Dharmendra, Bobby Deol, Sunny Deol #BollywoodSpy #BollywoodNews #BollywoodGossips - Stay Tuned For More Bollywood News
Check All Bollywood Latest Update on our Channel
Subscribe to our Channel https://goo.gl/UerBDn
Like us on Facebook https://goo.gl/7Q896J
Follow us on Twitter https://goo.gl/AjQfa4
Circle us on G+ https://goo.gl/57XqjC
Follow us on Instagram https://goo.gl/x48yEy
Watch Yamla Pagla Deewana Phir Se REVIEW By Expert Amarpreet Singh | Dharmendra, Bobby Deol, Sunny Deol With HD QualityBy Bollywood Spy| 228 views
Yamla Pagla Deewana Phir Se PUBLIC REVIEW | Second Show | Dharmendra, Bobby Deol, Sunny Deol
Yamla Pagla Deewana Phir Se PUBLIC REVIEW | Second Show | Dharmendra, Bobby Deol, Sunny Deol #BollywoodSpy #BollywoodNews #BollywoodGossips - Stay Tuned For More Bollywood News
Check All Bollywood Latest Update on our Channel
Subscribe to our Channel https://goo.gl/UerBDn
Like us on Facebook https://goo.gl/7Q896J
Follow us on Twitter https://goo.gl/AjQfa4
Circle us on G+ https://goo.gl/57XqjC
Follow us on Instagram https://goo.gl/x48yEy
Watch Yamla Pagla Deewana Phir Se PUBLIC REVIEW | Second Show | Dharmendra, Bobby Deol, Sunny Deol With HD QualityBy Bollywood Spy| 841 views
'Yamla Pagla Deewana: Phir Se' | Public Review | Sunny Deol, Bobby Deol, Dharmendra
Sunny Deol, Bobby Deol, Dharmendra - starrer 'Yamla Pagla Deewana: Phir Se' has hit the screens today, and here's what moviegoers have to say about the film.
Check out the video to know more
SUBSCRIBE To Bollywood Bubble:
Click Here ► http://bit.ly/2hjMB6X
Tune into Bollywood Bubble, your one stop destination for all the latest happenings, hot gossips, rumours and exclusive B-Town news...
Also, Visit - https://www.bollywoodbubble.com . One stop Destination for Latest Bollywood Updates.
Like us on Facebook - https://www.facebook.com/BollywoodBubble
Follow us on Twitter - https://twitter.com/bollybubble
Follow us on Instagram - www.instagram.com/bollywoodbubble
Click On the Subscribe Button NOW and Stay Tuned.Watch 'Yamla Pagla Deewana: Phir Se' | Public Review | Sunny Deol, Bobby Deol, Dharmendra With HD QualityBy Bollywood Bubble| 2901 views
Yamla Pagla Deewana Phir Se | Public Review | Dharmendra | Sunny Deol | Bobby Deol |Dainik Savera
Yamla Pagla Deewana Phir Se | Public Review | Dharmendra | Sunny Deol | Bobby Deol | Dainik Savera
Watch Yamla Pagla Deewana Phir Se | Public Review | Dharmendra | Sunny Deol | Bobby Deol |Dainik Savera With HD QualityBy Savera Star Talks| 1031 views
Yamla Pagla Deewana Phir Se | FIRST LOOK Out | Bobby Deol, Dharmendra, Sunny Deol
Yamla Pagla Deewana Phir Se | FIRST LOOK Out | Bobby Deol, Dharmendra, Sunny Deol
- Stay Tuned For More Bollywood News
Check All Bollywood Latest Update on our Channel
Subscribe to our Channel https://goo.gl/UerBDn
Like us on Facebook https://goo.gl/7Q896J
Follow us on Twitter https://goo.gl/AjQfa4
Circle us on G+ https://goo.gl/57XqjC
Follow us on Instagram https://goo.gl/x48yEy
Watch Yamla Pagla Deewana Phir Se | FIRST LOOK Out | Bobby Deol, Dharmendra, Sunny Deol With HD QualityBy Bollywood Spy| 13996 views
Yamla Pagla Deewana Phir Se TEASER OUT | Dharmendra, Sunny Deol, Bobby Deol, Salman Khan
Yamla Pagla Deewana Phir Se TEASER OUT | Dharmendra, Sunny Deol, Bobby Deol, Salman Khan - Stay Tuned For More Bollywood News
Check All Bollywood Latest Update on our Channel
Subscribe to our Channel https://goo.gl/UerBDn
Like us on Facebook https://goo.gl/7Q896J
Follow us on Twitter https://goo.gl/AjQfa4
Circle us on G+ https://goo.gl/57XqjC
Follow us on Instagram https://goo.gl/x48yEy
Watch Yamla Pagla Deewana Phir Se TEASER OUT | Dharmendra, Sunny Deol, Bobby Deol, Salman Khan With HD QualityBy Bollywood Spy| 489 views
Yamla Pagla Deewana Phir Se | Official Teaser | Dharmendra | Sunny Deol | Salman Khan | Bobby Deol
Yamla Pagla Deewana Phir Se
Directed by: Navaniat Singh
Produced by: Kamayani Punia Sharma, Aarushi Malhotra
Cast: Dharmendra, Sunny Deol, Bobby Deol, Kriti Kharbanda, Asrani, Satish Kaushik, Binnu Dhillon
Singers: Harrdy Sandhu, Sachet Tandon, Alam, Shahid Mallya, Jyotika Tangri
Choreographers: Remo D'souza, Adil Shaikh, Rajeev Surti
Action Director: Vikram Dahiya (Bunty)
Editor: Manish More
Production Designer: Rita Ghosh
Background Score: Raju Singh
Executive Producer: Rupesh Mali
Associate Director: Rahul Maniktala
Sound Designers: Parikshit Lalwani & Kunal Mehta
RELEASING ON 15th AUGUST
For More Latest News Update Do Not Forget To Subscribe
Watch Yamla Pagla Deewana Phir Se | Official Teaser | Dharmendra | Sunny Deol | Salman Khan | Bobby Deol With HD QualityBy Delhi Darpan TV| 1496 views
Yamla Pagla Deewana Phir Se TRAILER OUT | Salman Khan, Dharmendra, Sunny Deol, Bobby Deol
Yamla Pagla Deewana Phir Se TRAILER OUT | Salman Khan, Dharmendra, Sunny Deol, Bobby Deol #BollywoodSpy #BollywoodNews #BollywoodGossips - Stay Tuned For More Bollywood News
Check All Bollywood Latest Update on our Channel
Subscribe to our Channel https://goo.gl/UerBDn
Like us on Facebook https://goo.gl/7Q896J
Follow us on Twitter https://goo.gl/AjQfa4
Circle us on G+ https://goo.gl/57XqjC
Follow us on Instagram https://goo.gl/x48yEy
Watch Yamla Pagla Deewana Phir Se TRAILER OUT | Salman Khan, Dharmendra, Sunny Deol, Bobby Deol With HD QualityBy Bollywood Spy| 497 views
Yamla Pagla Deewana Phir Se | HONEST REVIEW | Dharmendra, Bobby Deol, Sunny Deol #BollywoodSpy #BollywoodNews #BollywoodGossips - Stay Tuned For More Bollywood News
Check All Bollywood Latest Update on our Channel
Subscribe to our Channel https://goo.gl/UerBDn
Like us on Facebook https://goo.gl/7Q896J
Follow us on Twitter https://goo.gl/AjQfa4
Circle us on G+ https://goo.gl/57XqjC
Follow us on Instagram https://goo.gl/x48yEy
Watch Yamla Pagla Deewana Phir Se | HONEST REVIEW | Dharmendra, Bobby Deol, Sunny Deol With HD Quality
#SalmanKhan#screening#sunnydeol#Dharmendra#ComedyMovie#bobbydeol#YamlaPaglaDeewanaPhirSetrailer#YamlaPaglaDeewanaPhirSetrailerlaunch#yamlapagladeewanaphirsetrailersongs#yamlapagladeewanaphirsefulltrailer#yamlapagladeewanaphirseofficialtrailer#yamlapagladeewanaphirsesong#yamlapagladeewanaphirseallvideosongs#dharmendrayamlapagladeewanamovie#YamlaPaglaDeewanaPhirSepublicreview#krtitikharbanda#raftarafta
Category:
Entertainment
Yamla Pagla Deewana Phir Se - Public Review - Dharmendra, Bobby Deol,Sunny Deol,Kriti Kharbanda
Watch Yamla Pagla Deewana Phir Se - Public Review - Dharmendra, Bobby Deol,Sunny Deol,Kriti Kharbanda With HD Quality
By BOLLYWOOD FLASH| 2532 views
Yamla Pagla Deewana Phir Se REVIEW By Expert Amarpreet Singh | Dharmendra, Bobby Deol, Sunny Deol
Yamla Pagla Deewana Phir Se REVIEW By Expert Amarpreet Singh | Dharmendra, Bobby Deol, Sunny Deol #BollywoodSpy #BollywoodNews #BollywoodGossips - Stay Tuned For More Bollywood News
Check All Bollywood Latest Update on our Channel
Subscribe to our Channel https://goo.gl/UerBDn
Like us on Facebook https://goo.gl/7Q896J
Follow us on Twitter https://goo.gl/AjQfa4
Circle us on G+ https://goo.gl/57XqjC
Follow us on Instagram https://goo.gl/x48yEy
Watch Yamla Pagla Deewana Phir Se REVIEW By Expert Amarpreet Singh | Dharmendra, Bobby Deol, Sunny Deol With HD QualityBy Bollywood Spy| 228 views
Yamla Pagla Deewana Phir Se PUBLIC REVIEW | Second Show | Dharmendra, Bobby Deol, Sunny Deol
Yamla Pagla Deewana Phir Se PUBLIC REVIEW | Second Show | Dharmendra, Bobby Deol, Sunny Deol #BollywoodSpy #BollywoodNews #BollywoodGossips - Stay Tuned For More Bollywood News
Check All Bollywood Latest Update on our Channel
Subscribe to our Channel https://goo.gl/UerBDn
Like us on Facebook https://goo.gl/7Q896J
Follow us on Twitter https://goo.gl/AjQfa4
Circle us on G+ https://goo.gl/57XqjC
Follow us on Instagram https://goo.gl/x48yEy
Watch Yamla Pagla Deewana Phir Se PUBLIC REVIEW | Second Show | Dharmendra, Bobby Deol, Sunny Deol With HD QualityBy Bollywood Spy| 841 views
'Yamla Pagla Deewana: Phir Se' | Public Review | Sunny Deol, Bobby Deol, Dharmendra
Sunny Deol, Bobby Deol, Dharmendra - starrer 'Yamla Pagla Deewana: Phir Se' has hit the screens today, and here's what moviegoers have to say about the film.
Check out the video to know more
SUBSCRIBE To Bollywood Bubble:
Click Here ► http://bit.ly/2hjMB6X
Tune into Bollywood Bubble, your one stop destination for all the latest happenings, hot gossips, rumours and exclusive B-Town news...
Also, Visit - https://www.bollywoodbubble.com . One stop Destination for Latest Bollywood Updates.
Like us on Facebook - https://www.facebook.com/BollywoodBubble
Follow us on Twitter - https://twitter.com/bollybubble
Follow us on Instagram - www.instagram.com/bollywoodbubble
Click On the Subscribe Button NOW and Stay Tuned.Watch 'Yamla Pagla Deewana: Phir Se' | Public Review | Sunny Deol, Bobby Deol, Dharmendra With HD QualityBy Bollywood Bubble| 2901 views
Yamla Pagla Deewana Phir Se | Public Review | Dharmendra | Sunny Deol | Bobby Deol |Dainik Savera
Yamla Pagla Deewana Phir Se | Public Review | Dharmendra | Sunny Deol | Bobby Deol | Dainik Savera
Watch Yamla Pagla Deewana Phir Se | Public Review | Dharmendra | Sunny Deol | Bobby Deol |Dainik Savera With HD QualityBy Savera Star Talks| 1031 views
Yamla Pagla Deewana Phir Se | FIRST LOOK Out | Bobby Deol, Dharmendra, Sunny Deol
Yamla Pagla Deewana Phir Se | FIRST LOOK Out | Bobby Deol, Dharmendra, Sunny Deol
- Stay Tuned For More Bollywood News
Check All Bollywood Latest Update on our Channel
Subscribe to our Channel https://goo.gl/UerBDn
Like us on Facebook https://goo.gl/7Q896J
Follow us on Twitter https://goo.gl/AjQfa4
Circle us on G+ https://goo.gl/57XqjC
Follow us on Instagram https://goo.gl/x48yEy
Watch Yamla Pagla Deewana Phir Se | FIRST LOOK Out | Bobby Deol, Dharmendra, Sunny Deol With HD QualityBy Bollywood Spy| 13996 views
Yamla Pagla Deewana Phir Se TEASER OUT | Dharmendra, Sunny Deol, Bobby Deol, Salman Khan
Yamla Pagla Deewana Phir Se TEASER OUT | Dharmendra, Sunny Deol, Bobby Deol, Salman Khan - Stay Tuned For More Bollywood News
Check All Bollywood Latest Update on our Channel
Subscribe to our Channel https://goo.gl/UerBDn
Like us on Facebook https://goo.gl/7Q896J
Follow us on Twitter https://goo.gl/AjQfa4
Circle us on G+ https://goo.gl/57XqjC
Follow us on Instagram https://goo.gl/x48yEy
Watch Yamla Pagla Deewana Phir Se TEASER OUT | Dharmendra, Sunny Deol, Bobby Deol, Salman Khan With HD QualityBy Bollywood Spy| 489 views
Yamla Pagla Deewana Phir Se | Official Teaser | Dharmendra | Sunny Deol | Salman Khan | Bobby Deol
Yamla Pagla Deewana Phir Se
Directed by: Navaniat Singh
Produced by: Kamayani Punia Sharma, Aarushi Malhotra
Cast: Dharmendra, Sunny Deol, Bobby Deol, Kriti Kharbanda, Asrani, Satish Kaushik, Binnu Dhillon
Singers: Harrdy Sandhu, Sachet Tandon, Alam, Shahid Mallya, Jyotika Tangri
Choreographers: Remo D'souza, Adil Shaikh, Rajeev Surti
Action Director: Vikram Dahiya (Bunty)
Editor: Manish More
Production Designer: Rita Ghosh
Background Score: Raju Singh
Executive Producer: Rupesh Mali
Associate Director: Rahul Maniktala
Sound Designers: Parikshit Lalwani & Kunal Mehta
RELEASING ON 15th AUGUST
For More Latest News Update Do Not Forget To Subscribe
Watch Yamla Pagla Deewana Phir Se | Official Teaser | Dharmendra | Sunny Deol | Salman Khan | Bobby Deol With HD QualityBy Delhi Darpan TV| 1496 views
Yamla Pagla Deewana Phir Se TRAILER OUT | Salman Khan, Dharmendra, Sunny Deol, Bobby Deol
Yamla Pagla Deewana Phir Se TRAILER OUT | Salman Khan, Dharmendra, Sunny Deol, Bobby Deol #BollywoodSpy #BollywoodNews #BollywoodGossips - Stay Tuned For More Bollywood News
Check All Bollywood Latest Update on our Channel
Subscribe to our Channel https://goo.gl/UerBDn
Like us on Facebook https://goo.gl/7Q896J
Follow us on Twitter https://goo.gl/AjQfa4
Circle us on G+ https://goo.gl/57XqjC
Follow us on Instagram https://goo.gl/x48yEy
Watch Yamla Pagla Deewana Phir Se TRAILER OUT | Salman Khan, Dharmendra, Sunny Deol, Bobby Deol With HD QualityBy Bollywood Spy| 497 views
Bollywood Spy
Bigg Boss 13 | Asim Riaz Vs Sidharth Fan On DHAKKA | Bigg Charcha | BB 13 Video
Bigg Boss 13 | Asim Riaz Vs Sidharth Fan On DHAKKA | Bigg Charcha | BB 13 Video
#biggboss13 #bb13- Stay Tuned For More Bollywood News
☞ Check All Bollywood Latest Update on our Channel
☞ Subscribe to our Channel https://goo.gl/UerBDn
☞ Like us on Facebook https://goo.gl/7Q896J
☞ Follow us on Twitter https://goo.gl/AjQfa4
☞ Circle us on G+ https://goo.gl/57XqjC
☞ Follow us on Instagram https://goo.gl/x48yEy
Watch Bigg Boss 13 | Asim Riaz Vs Sidharth Fan On DHAKKA | Bigg Charcha | BB 13 Video With HD QualityBy Bollywood Spy| 112 views
Bigg Boss 13 | ASIM VS WHOLE HOUSE | Rashmi May Join Sidharth | BB 13 Video
Bigg Boss 13 | ASIM VS WHOLE HOUSE | Rashmi May Join Sidharth | BB 13 Video
#biggboss13 #bb13 - Stay Tuned For More Bollywood News
☞ Check All Bollywood Latest Update on our Channel
☞ Subscribe to our Channel https://goo.gl/UerBDn
☞ Like us on Facebook https://goo.gl/7Q896J
☞ Follow us on Twitter https://goo.gl/AjQfa4
☞ Circle us on G+ https://goo.gl/57XqjC
☞ Follow us on Instagram https://goo.gl/x48yEy
Watch Bigg Boss 13 | ASIM VS WHOLE HOUSE | Rashmi May Join Sidharth | BB 13 Video With HD QualityBy Bollywood Spy| 107 views
Urvashi Rautela DHAMAKEDAR Rapid Fire | Salman Khan As Bodybuilder, Shahrukh Khan As Acting Tutor
Urvashi Rautela DHAMAKEDAR Rapid Fire | Salman Khan As Bodybuilder, Shahrukh Khan As Acting Tutor
#urvashirautela - Stay Tuned For More Bollywood News
☞ Check All Bollywood Latest Update on our Channel
☞ Subscribe to our Channel https://goo.gl/UerBDn
☞ Like us on Facebook https://goo.gl/7Q896J
☞ Follow us on Twitter https://goo.gl/AjQfa4
☞ Circle us on G+ https://goo.gl/57XqjC
☞ Follow us on Instagram https://goo.gl/x48yEyWatch Urvashi Rautela DHAMAKEDAR Rapid Fire | Salman Khan As Bodybuilder, Shahrukh Khan As Acting Tutor With HD QualityBy Bollywood Spy| 72 views
Fashion
My Night Skin Care routine 2020
#sinhala #beautywithsumu #srilankanbeautytherapist #spaceylon #nightskincareroutine #glassskin
#skinlightening #oilyskintreatment #oilyskincare
Hey Beauties
As you requested i thought to make a review of my current night skin care routine.for more detail please keep watching ????????
I hope you will like this video and Don't forget to hit the SUBSCRIBE button.
Product i used
step 1 Double Cleansing
WHITE MINT - Facial Cleansing Foam (RS:3100)
https://bit.ly/30uQhGY
step 2 Exfoliating
NEEM & TEA TREE - Refining Natural Exfoliator (RS:3900)
https://bit.ly/30tgjKz
step 3 Toning (RS:3200)
WHITE MINT – Facial Skin Tonic
https://bit.ly/30rQnPp
step 4 Facial Masque (RS:3250)
NEEM & TEA TREE - Overnight Treatment Masque
https://bit.ly/2TpAIPa
Spa Ceylon in Social media
Official Site : https://lk.spaceylon.com/
Facebook https://www.facebook.com/SpaCeylonAyu...
Instagram https://www.instagram.com/spaceylonof...
already done about eye cream and lip balm so please check out them
Lip Balm https://bit.ly/2RqmTxe
Eye Cream https://bit.ly/2R1JoK9
facebook https://www.facebook.com/beautywithsumu/
instagram https://www.instagram.com/beautywiths...
email beautywithsumu@gmail.com
Watch My Night Skin Care routine 2020 With HD QualityBy Beauty with Sumu| 18052 views
Secret to Flawless Younger Skin | Ageless Serum with Hyaluronic acid | Simple Skincare for Winters
hey Guys,
Today we are talking about face serums and everything you need to know about them.
We will see how and why Face Serums are more effective than moisturizers and and how to use and apply face serum on everyday basis to see results quickly.
I have been using Mama Earth Skin Plump Face serum which is best for fine lines and aging skin.
and have seen tremendous difference in my skin. Its really good.
You can buy it here -
Website: http://bit.ly/2ZmglDB (Use code nidhi2020 for 20% off at mamaearth.in)
Amazon:https://amzn.to/2EUfNeA
Nykaa: http://bit.ly/34XmmYg
Follow me on all my social media's below:
email :prettysimplenk@gmail.com
Facebook: https://www.facebook.com/prettysimplenk/
Twitter : https://twitter.com/prettysimplenk
Instagram - https://www.instagram.com/nidhi.167/
This Video is Sponsored by Mama Earth.
how to apply face serum,how to apply face serum in hindi,applying face serum,apply face serum hindi,face serum tutorial,face serum tutorial hindi,how to use face serum,face serum at home,face serum for makeup,face serum,face serum hindi,what are face serums, how to use face serum, which is the best face serum, face serum for fine lines, face serum for acne marks, niacinamide face serums, hyaluronic acid face serum
Watch Secret to Flawless Younger Skin | Ageless Serum with Hyaluronic acid | Simple Skincare for Winters With HD QualityBy Nidhi Katiyar| 11848 views
Beautiful Hairstyle For Party/Wedding 2019 | Easy Hairstyles For Long Hair
Please subscribe & share for more videos:
Subscribe: https://goo.gl/cWHPBJ
Beautiful Hairstyle For Party/Wedding 2019 | Easy Hairstyles For Long Hair
Watch Beautiful Hairstyle For Party/Wedding 2019 | Easy Hairstyles For Long Hair With HD QualityBy Saheli Tutorials| 19810 views
What's New in Affordable ? | Trying out new Affordable Makeup | Swiss beauty Las Vegas Palette
Hey guys, Today I am going to try out some new affordable makeup.
Especially the newly launched, Swiss Beauty Las Vegas Eyeshadow Plus Cheek Palette and Maliao Eyeliner + Mascara.
5. Maliao Lip Palette - Rs. 199
https://www.cuffsnlashes.com/maliao-sealed-with-a-kiss-lip-palette
6. 20 Something Makeup Fixer - Rs. 125
https://www.cuffsnlashes.com/20-something-makeup-fixer35ml-aloe-vera-with-vitamin-e
whats new in affordable,affordable makeup,nidhi katiyar,makeup try on haul,swiss beauty las vegas palette review,swiss beauty las vegas,swiss beauty,affordable makeup try on,sfr concealer palette review,sfr color,Maliao lip Palette,maliao mascara review,maliao mascara,maliao,maliao eyeliner waterproof,maliao eyeliner review,maliao eyeliner price,maliao double effect mascara and eyeliner,maliao review,affordable makeup india,nidhi katiyar makeupBy Nidhi Katiyar| 16167 views
My Favourite Skincare Products of 2019 | JSuper Kaur
My Best Skin Care Product of 2019
*************************************************************************************************************
Product Links :
1.Merit Vco Extra Virgin Coconut Oil : https://amzn.to/36YKw6R
2. Mamaearth Bye Bye Blemishes : https://amzn.to/388xuUr
3. Kama Ayurveda Kumkumadi : https://amzn.to/2FTCSPh
4. Plum Green Tea : https://amzn.to/3aeHnBR
5. Kiehl's Turmeric & Cranberry Seed : https://amzn.to/38661Tc
6. Tinkle Eyebrow Shaper : https://amzn.to/2Nxnr3d
7. The Face Shop Aloe Fresh Soothing Moisture Gel : https://amzn.to/2R0pFu0
8. Kama Ayurveda Pure Rose : https://amzn.to/2TtcvHN
**************************************************************************************************************
Camera Used : https://amzn.to/318ppMI
Vlog Camera : https://amzn.to/2QLo5e3
Shooting Lights : https://amzn.to/2ETZ5fL
Ring Light : https://amzn.to/31ldcVc
Tripod Used : https://amzn.to/2WMVA4W
My Fav Lipstick Colour : https://amzn.to/2WQz7E4
: https://amzn.to/2WHV9sR
: https://amzn.to/2QNDzOF
: https://amzn.to/2Kr07n6
***********************************************************************
For Make & Beauty Tips Subscribe to my other channel
Super Beauty : https://www.youtube.com/channel/UCG2yeNDaXoJCjtUNlZi15Dw
Follow me on all social media & be my Friend! Please do Like, Subscribe & Share :-
* YouTube : http://www.youtube.com/c/JSuperkaurbeauty
* Facebook : https://www.facebook.com/JSuper.Kaur
* Instagram : https://www.instagram.com/jsuper.kaur
* Twitter : https://twitter.com/JsuperKaur
* Google+ : https://plus.google.com/+JSuperkaur
* Website : www.jsuperkaur.com
For Business Inquiries -
E-Mail : jsuperkaur@gmail.com
<By JSuper kaur| 14420 views
How to make a (tasty) Vegetable Salad (Recipe)| Hindi Cooking Video|
Hey guys! In this video I've shared how I make my vegetable salad really tasty and healthy at the same time. This is what works as per my diet and exercise routine. You can tweak the ingredients as per your taste and what works for your diet. I like to have a protein rich vegetarian diet which is low on carbs. At the moment, I've been gluten free for over a month and would love to share more on the same on my Instagram or in a youtube video. Please do let me know in the comments if you'd be interested to see more vegetarian recipe videos.
Lots of love.
Music: Ice Cream,Youtube Audio Library.
Follow me on my social media:
Facebook: https://www.facebook.com/nehadesai21
Instagram: https://www.instagram.com/nehadesai.blog
Twitter: https://twitter.com/neaadesai
Snapchat: https://www.snapchat.com/add/neaa2106
Digitally Powered by One Digital Entertainment [https://www.facebook.com/OneDigitalEntertainment]
[Website - http://www.onedigitalentertainment.com]Watch How to make a (tasty) Vegetable Salad (Recipe)| Hindi Cooking Video| With HD QualityBy Neha Desai| 13553 views
Trending Now
Recommended
#WalkWithKejriwal | AAP National Convenor Arvind Kejriwal's Nomination Roadshow
#WalkWithKejriwal | AAP National Convenor Arvind Kejriwal's Nomination Roadshow
__________________________________________________________________________________
The New Arvind Kejriwal App Launched | Download AK App from https://play.google.com/store/apps/details?id=com.arvindkejriwalapp
Watch Other Speeches of Arvind Kejriwal
1. Arvind Kejriwal on Delhi Water Crisis: https://bit.ly/2O8DsQ7
2. Arvind Kejriwal ने बताया क्यों ज़रूरी है स्कूल में CCTV कैमरे लगवाना https://bit.ly/32BtKIZ
3. Arvind Kejriwal on the inauguration of India’s largest Water Sewage Treatment Plant (STP) : https://bit.ly/2LxxfuF
4. Arvind Kejriwal on Education System in India: https://bit.ly/2XQEmoN
Follow Arvind Kejriwal on Twitter: https://www.twitter.com/ArvindKejriwal
Follow Arvind Kejriwal on Facebook: https://www.facebook.com/AAPkaArvind/
Follow Aam Aadmi Party on Facebook: https://www.facebook.com/AamAadmiParty
Follow Aam Aadmi Party on Twitter: https://www.twitter.com/AamAadmiParty
Watch #WalkWithKejriwal | AAP National Convenor Arvind Kejriwal's Nomination Roadshow With HD QualityBy AAP| 13478 views
आज देश में जो बेरोजगारी की स्थिति है उससे युवाओं के मन में डर का महौल है: राहुल गांधी
आज देश में जो बेरोजगारी की स्थिति है उससे युवाओं के मन में डर का महौल है: राहुल गांधी
Declaration:
This video is an intellectual property belonging to the Indian National Congress. Please seek prior permission before using any part of this video in any form.
For more videos, subscribe to Congress Party channel: https://www.youtube.com/user/indiacongress
Follow Indian National Congress!
Follow the Indian National Congress on
Facebook: https://www.facebook.com/IndianNationalCongress
Twitter:https://twitter.com/INCIndia
Instagram: https://www.instagram.com/incindia/
YouTube: https://www.youtube.com/user/indiacongress
Follow Rahul Gandhi on
YouTube: https://www.youtube.com/c/rahulgandhi/
Facebook: https://www.facebook.com/rahulgandhi/
Twitter: https://twitter.com/rahulgandhi/
Instagram: https://www.instagram.com/rahulgandhi/
Watch आज देश में जो बेरोजगारी की स्थिति है उससे युवाओं के मन में डर का महौल है: राहुल गांधी With HD QualityBy Indian National Congress| 10028 views
Zomato acquires UberEats India in all-stock deal, first big consolidation in food delivery space
Zomato on Tuesday announced that it has acquired Uber's Food Delivery Business in India in an all-stock deal and Uber will have 9.99 per cent stake in the Deepinder Goyal-led food delivery platform. According to sources close to the deal, it is in the range of over $350 million or nearly Rs 2,500 crore. Uber Eats in India will discontinue operations and direct restaurants, delivery partners, and users of the Uber Eats apps to the Zomato platform, effective from Tuesday.
► Subscribe to The Economic Times for latest video updates. It's free! - http://www.youtube.com/TheEconomicTimes?sub_confirmation=1
► More Videos @ ETTV - http://economictimes.indiatimes.com/TV
► http://EconomicTimes.com
► For business news on the go, download ET app:
https://etapp.onelink.me/tOvY/EconomicTimesApp
Follow ET on:
► Facebook - https://www.facebook.com/EconomicTimes
► Twitter - http://www.twitter.com/economictimes
► LinkedIn - http://www.linkedin.com/company/economictimes
► Instagram - https://www.instagram.com/the_economic_times
► Flipboard - https://flipboard.com/@economictimes
The Economic Times | A Times Internet Limited product
Watch Zomato acquires UberEats India in all-stock deal, first big consolidation in food delivery space With HD QualityBy The Economic Times| 139 views
'हलवा रस्म' के साथ आज से बजट की छपाई शुरू
'हलवा रस्म' के साथ आज से बजट की छपाई शुरू
Watch 'हलवा रस्म' के साथ आज से बजट की छपाई शुरू With HD QualityBy NewsFirst.TV| 12714 views
India ने लॉन्च की K-4 Ballistic Missile, खूबियां के चलते K-4 बना Black Project
India ने रविवार को Andhra Pradesh के तट से K-4 Ballistic Missile का सफल टेस्ट किया। हालाँकि इस टेस्ट की आधिकारिक घोषणा न तो Defence Ministry ने की है और न ही Defence Research And Development Organisation रिसर्च एंड डेवलपमेंट आर्गेनाईजेशन ( डीआरडीओ) ने। इसकी घोषणा इसलिए नहीं हुई क्योंकि इसका निर्माण DRDO ने जिस प्रोजेक्ट के तहत किया है उसका नाम Black Project है क्योंकि अति संवेदनशील जानकारी होने के चलते इस प्रोजेक्ट में काफी गोपनीयता बरती गई है । K-4 एक सब मरीन लॉन्चड बैलिस्टिक मिसाइल (SLBM) है जिसे समुन्द्र की गहराईओं में पनडुब्बी से लॉन्च किया जा सकता है। जिस अरिहंत पनडुब्बी से K-4 को लॉन्च किया गया वो भारत की पहली स्वदेशी परमाणु पनडुब्बी है। K-4 का नाम भारत के मिसाइल मैन और दिवंगत पूर्व राष्ट्रपति डॉक्टर APJ अब्दुल कलाम के नाम पर रखा गया है, K का मतलब है कलाम।
To Subscribe on Youtube:
https://www.youtube.com/user/punjabkesaritv
Follow us on Twitter :
https://twitter.com/punjabkesari
Like us on FB:
https://www.facebook.com/Pkesarionline/
Watch India ने लॉन्च की K-4 Ballistic Missile, खूबियां के चलते K-4 बना Black Project With HD QualityBy PunjabKesari TV| 56 views
