Ad 30s Skip Ad in 5s -Skip Ad-
Visit advertiser site
  • Aukaat | Waqt Sabka Badalta Hai | गरीब vs अमीर | The Unexpected Twist | Indian Swaggers

    Aukaat | Waqt Sabka Badalta Hai | गरीब vs अमीर | The Unexpected Twist | Indian Swaggers

    Concept based on "Waqt Sabka Badalta Hai" New Video by Indian Swaggers in which a guy plays a brilliant role गरीब Boyfriend when and fall in love with अमीर Girlfriend and then time changes .
    Sumit Dhiran
    Aniket karan
    Neha Jangra
    Rahul Thakur

    Do subscribe this channel - Bekrazy
    ( )
    Join us on social media accounts :-

    For Brand Sponsor and Collab -
    If I uploaded a song that's yours and you want it removed just contact me through my E-mail or just send YouTube message .

    Managed by-
    #waqtsabkabadaltahai #qismat

    Disclaimer - This video is just for Fun and making you all laugh. I make video only to entertain people and make them laugh . People don't get offended by video . Because it is just for the purpose of entertainment . Thank You for Watching....
    Don't Forget to Subscribe & Hit the bell to watch more Latest Desi Funny Videos of Indian Swaggers

    Watch Aukaat | Waqt Sabka Badalta Hai | गरीब vs अमीर | The Unexpected Twist | Indian Swaggers With HD Quality

    By Indian Swaggers| 2257 views

  • Aukaat | गरीब vs अमीर | Roadpati Bana Crorepati | Waqt Sabka Badalta hai | Indian Swaggers

    Aukaat | गरीब vs अमीर | Roadpati Bana Crorepati | Waqt Sabka Badalta hai | Indian Swaggers

    Join us on social media accounts :-

    For Brand Sponsor and Collab -
    If I uploaded a song that's yours and you want it removed just contact me through my E-mail or just send YouTube message .

    Managed by-
    #roadpatibanacrorepati #waqtsabkabadaltahai

    Disclaimer - This video is just for Fun and making you all laugh. I make video only to entertain people and make them laugh . People don't get offended by video . Because it is just for the purpose of entertainment . Thank You for Watching....
    Don't Forget to Subscribe & Hit the bell to watch more Latest Desi Funny Videos of Indian Swaggers

    Watch Aukaat | गरीब vs अमीर | Roadpati Bana Crorepati | Waqt Sabka Badalta hai | Indian Swaggers With HD Quality

    By Indian Swaggers| 1299 views

  • गरीब Vs अमीर | Qismat | Waqt Sabka Badalta hai | Time Changes | Aukaat | Indian Swaggers

    गरीब Vs अमीर | Qismat | Waqt Sabka Badalta hai | Time Changes | Aukaat | Indian Swaggers

    Concept based on "Waqt Sabka Badalta Hai" New Video by Indian Swaggers.

    Download Ballebaazi app:
    Manage by:
    ( )

    Sumit Dhiran
    Aniket karan
    chandni Jah
    Rahul thakur

    Join us on social media accounts :-

    For Brand Sponsor and Collab -
    If I uploaded a song that's yours and you want it removed just contact me through my E-mail or just send YouTube message .
    #waqtsabkabadaltahai #garibvsamir #aukaat

    Disclaimer - This video is just for Fun and making you all laugh. I make video only to entertain people and make them laugh . People don't get offended by video . Because it is just for the purpose of entertainment . Thank You for Watching....
    Don't Forget to Subscribe & Hit the bell to watch more Latest Desi Funny Videos of Indian Swaggers

    Watch गरीब Vs अमीर | Qismat | Waqt Sabka Badalta hai | Time Changes | Aukaat | Indian Swaggers With HD Quality

    By Indian Swaggers| 959 views

  • गरीब Vs अमीर | Bezzati | गरीब का मजाक | Aukaat | Waqt Sabka Badalta hai | Time Changes

    गरीब Vs अमीर | Bezzati | गरीब का मजाक | Aukaat | Waqt Sabka Badalta hai | Time Changes

    Concept based on "Waqt Sabka Badalta Hai" New Video by Indian Swaggers in which a guy plays a brilliant role गरीब Boyfriend when and fall in love with अमीर Girlfriend and then time changes .
    Sumit Dhiran
    Aniket karan
    Neha Jangra
    Rahul Thakur
    Child Appearance - (Monty And Puchu)
    Do subscribe this channel - Bekrazy

    Join us on social media accounts :-

    For Brand Sponsor and Collab -
    If I uploaded a song that's yours and you want it removed just contact me through my E-mail or just send YouTube message .

    Managed by-
    #waqtsabkabadaltahai #qismat

    Disclaimer - This video is just for Fun and making you all laugh. I make video only to entertain people and make them laugh . People don't get offended by video . Because it is just for the purpose of entertainment . Thank You for Watching....
    Don't Forget to Subscribe & Hit the bell to watch more Latest Desi Funny Videos of Indian Swaggers

    Watch गरीब Vs अमीर | Bezzati | गरीब का मजाक | Aukaat | Waqt Sabka Badalta hai | Time Changes With HD Quality

    By Indian Swaggers| 681 views

  • गरीब vs अमीर | Waqt Sabka Badalta Hai | Aukaat | Qismat | गरीब का मज़ाक | Time Changes

    गरीब vs अमीर | Waqt Sabka Badalta Hai | Aukaat | Qismat | गरीब का मज़ाक | Time Changes

    Concept based on "Waqt Sabka Badalta Hai" New Video by Indian Swaggers in which a guy plays a brilliant role गरीब Boyfriend when and fall in love with अमीर Girlfriend and then time changes .
    Sumit Dhiran
    Aniket karan
    Rahul thakur.
    Rahul singh

    Join us on social media accounts :-

    For Brand Sponsor and Collab -
    If I uploaded a song that's yours and you want it removed just contact me through my E-mail or just send YouTube message .

    Managed by-
    #roadpatibanacrorepati #aukaat #waqtsabkabadaltahai

    Disclaimer - This video is just for Fun and making you all laugh. I make video only to entertain people and make them laugh . People don't get offended by video . Because it is just for the purpose of entertainment . Thank You for Watching....
    Don't Forget to Subscribe & Hit the bell to watch more Latest Desi Funny Videos of Indian Swaggers

    Watch गरीब vs अमीर | Waqt Sabka Badalta Hai | Aukaat | Qismat | गरीब का मज़ाक | Time Changes With HD Quality

    By Indian Swaggers| 212 views

  • गरीब vs अमीर | Time Changes | गरीब का मज़ाक | Waqt Sabka Badalta Hai | Aukaat | Qismat

    गरीब vs अमीर | Time Changes | गरीब का मज़ाक | Waqt Sabka Badalta Hai | Aukaat | Qismat

    Concept based on "Waqt Sabka Badalta Hai" New Video by Indian Swaggers in which a guy plays a brilliant role गरीब Boyfriend when and fall in love with अमीर Girlfriend
    Watch गरीब vs अमीर | Time Changes | गरीब का मज़ाक | Waqt Sabka Badalta Hai | Aukaat | Qismat With HD Quality

    By Indian Swaggers| 219 views

  • Waqt Sabka Badalta Hai | गरीब Boyfriend अमीर Girlfriend | 10वीं फेल बना करोड़पति | Indian Swaggers

    Waqt Sabka Badalta Hai | गरीब Boyfriend अमीर Girlfriend | 10वीं फेल बना करोड़पति | Indian Swaggers

    10वीं फेल बना करोड़पति Concept based on "Waqt Sabka Badalta Hai" New Video by Indian Swaggers in which a guy plays a brilliant role when it was shows that life after गरीब vs अमीर .
    Sumit Dhiran
    Aniket karan
    Himanshu Dabas
    Rahul thakur

    Join us on social media accounts :-

    For Brand Sponsor and Collab -
    If I uploaded a song that's yours and you want it removed just contact me through my E-mail or just send YouTube message .

    Watch Waqt Sabka Badalta Hai | गरीब Boyfriend अमीर Girlfriend | 10वीं फेल बना करोड़पति | Indian Swaggers With HD Quality

    By Indian Swaggers| 2607 views

  • Waqt Sabka Badalta Hai | गरीब और अमीर दोस्त की कहानी  | Thukra Ke Mera Pyar | Indian Swaggers

    Waqt Sabka Badalta Hai | गरीब और अमीर दोस्त की कहानी | Thukra Ke Mera Pyar | Indian Swaggers

    So this Concept based on "Waqt Sabka Badalta Hai" New Video 2019 by Indian Swaggers in which a Aniket Plays a brilliant role when he was (गरीब) poor and ask his rich friend ( अमीर दोस्त ) to help him and shows love to his beloved but don't het return in favour.

    Sumit Dhiran
    Aniket karan

    Join us on social media accounts :-

    For Brand Sponsor and Collab -

    Do subscribe this channel -

    If I uploaded a song that's yours and you want it to be removed so just contact me through my E-mail or just send YouTube message .

    Managed by-
    #waqtsabkabadaltahai #inteqam #yaarateriyaari

    Don't Forget to Subscribe & Hit the bell to watch more Latest Desi Funny Videos of Indianswagger

    Watch Waqt Sabka Badalta Hai | गरीब और अमीर दोस्त की कहानी | Thukra Ke Mera Pyar | Indian Swaggers With HD Quality

    By Indian Swaggers| 2687 views

  • गरीब Boyfriend अमीर Girlfriend | Waqt Sabka Badalta Hai | Paisa Ya Pyar | Indian Swaggers

    गरीब Boyfriend अमीर Girlfriend | Waqt Sabka Badalta Hai | Paisa Ya Pyar | Indian Swaggers

    Paisa Ya Pyar Concept based on "Waqt Sabka Badalta Hai" New Video by Indian Swaggers in which a guy plays a brilliant role गरीब Boyfriend when and fall in love with अमीर Girlfriend and then time changes .
    Sumit Dhiran
    Aniket karan

    Do subscribe this channel -

    Join us on social media accounts :-

    For Brand Sponsor and Collab -
    If I uploaded a song that's yours and you want it removed just contact me through my E-mail or just send YouTube message .

    Managed by-
    #waqtsabkabadaltahai #paisayapyar

    Disclaimer - This video is just for Fun and making you all laugh. I make video only to entertain people and make them laugh . People don't get offended by video . Because it is just for the purpose of entertainment . Thank You for Watching....
    Don't Forget to Subscribe & Hit the bell to watch more Latest Desi Funny Videos of Indian Swaggers

    Watch गरीब Boyfriend अमीर Girlfriend | Waqt Sabka Badalta Hai | Paisa Ya Pyar | Indian Swaggers With HD Quality

    By Indian Swaggers| 1150 views


गरीब और अमीर दोस्त की कहानी | Aukaat | Waqt Sabka Badalta Hai | गरीब vs अमीर | Indian Swaggers

Concept based on "Waqt Sabka Badalta Hai" New Video by Indian Swaggers in which a guy plays a brilliant role गरीब Boyfriend when and fall in love with अमीर Girlfriend

Watch गरीब और अमीर दोस्त की कहानी | Aukaat | Waqt Sabka Badalta Hai | गरीब vs अमीर | Indian Swaggers With HD Quality

#गरीबऔरअमीरदोस्तकीकहानी  #गरीबvsअमीर  #waqtsabkabadaltahai  #aukaat  #rahulthakur  #aukatemotionalvideo  #waktsabkabadaltahai  #Inteqaam  #aukaatvideo  #bezzativideo  #waqtsabkabadaltahainew  #aukatdekhegi  #gareebvsameer  #garibauramirkidosti  #thukrakemerapyarmerainteqamdekhegi  #wevirus  #waqtbadaltahaivideo  #गरीबऔरअमीरदोस्त  #shekharpant  #गरीबकामज़ाक  #गरीबdostअमीरdost  #waqtsabkabadaltahai  #qismat  #timechanges  #youthiyaboyzz  #indianswaggers  



Show More [+]
Show Less [-]


  • Shopping Worth Rs1,00,000 ???? Gone Wrong - Chandigarh

    Shopping Worth Rs1,00,000 ???? Gone Wrong - Chandigarh

    Urban theka
    Address -
    227, Elante Mall, Purv Marg, Industrial Area Phase I, Chandigarh, 160002 (2ND floor)

    Follow Them on instagram

    You can also visit there website


    1)oud perfumes
    For order
    Call/whatsapp - 9888881908

    Also visit ther website -

    FB -
    EMAIL :

    Managed by A venture by Promoedge Media Pvt Ltd)
    Business enquiry -

    Watch Shopping Worth Rs1,00,000 ???? Gone Wrong - Chandigarh With HD Quality

    By GAURAVZONE| 197 views

  • Short Film - NOT KILLED | Sukhpal Sidhu | FULL HD | New Hindi Short Movie (With English Subtitles)

    Short Film - NOT KILLED | Sukhpal Sidhu | FULL HD | New Hindi Short Movie (With English Subtitles)

    Short Film - NOT KILLED | Sukhpal Sidhu | FULL HD | New Hindi Short Movie (With English Subtitles)

    Watch Short Film - NOT KILLED | Sukhpal Sidhu | FULL HD | New Hindi Short Movie (With English Subtitles) With HD Quality

    By Anita Films Hindi| 174 views

  • What's wrong ! पुराचा कहर , लावारीस जिंदगी ! पुणे महापुर | Short film

    What's wrong ! पुराचा कहर , लावारीस जिंदगी ! पुणे महापुर | Short film

    Title - Whats wrong ! पुराचा कहर , लावारीस जिंदगी ! पुणे महापुर

    actor - Yuvraj Ingawale , Nitin Aswar ,Vilas hole ,Bhau tupe ,Vishal Tarate , Vikrant
    Producer - Trimurti Misal House
    Director - Vilas hole
    cameraman - Atul Thorave
    Editor - Somnath Aswar

    Watch What's wrong ! पुराचा कहर , लावारीस जिंदगी ! पुणे महापुर | Short film With HD Quality

    By Krishna Film Production| 278 views


  • All About Facial Serums And How To Use For Good Results

    All About Facial Serums And How To Use For Good Results

    Watch All About Facial Serums And How To Use For Good Results With HD Quality

    By Beauty with Sumu| 187 views

  • Style Talk With Bollywood Actress Surveen Chawla | Lakme Fashion Week - Winter Festive 2015

    Style Talk With Bollywood Actress Surveen Chawla | Lakme Fashion Week - Winter Festive 2015

    Lakme Fashion Week - Winter Festive 2015 proved to be a grandeur of extremity in fashion and styling. The 'Hate Story 2' fame Surveen Chawla walked the red carpet in an exclusive outfit which she calls 'Edgy Trails'. She added that her outfit represents her own personality with a touch of elegance and a power of fierceness.

    Lakme Fashion Week Winter Festive 2015 Send in your entries to or

    Subscribe to us on
    Like us on
    Follow us on
    Register on
    To view more exciting Live beams, Download the #fame App or visit:
    #fame- Go Live & Be A Star| Watch & Discover Live Videos | Follow & Chat Live With Celebs & #famestars - Anywhere, Anytime!
    Stay Connected with #fame on:
    Snapchat: liveonfameWatch Style Talk With Bollywood Actress Surveen Chawla | Lakme Fashion Week - Winter Festive 2015 With HD Quality

    By fame School Of Style| 17877 views

  • how to wear dupatta in different styles ?Style Dupatta in  Different Ways.use of dupatta for girls

    how to wear dupatta in different styles ?Style Dupatta in Different Ways.use of dupatta for girls

    Hi Guys!
    In this video I'm showing how to style your dupatta different ways. I hope you all enjoy! Which one is your favorite look? Comment below .)

    Duptta, saree, juda(Bun) isi type ke videos ke channel ko subscibe karen
    # sahelitutorials #dupttastyle
    #Style Dupatta
    #saheli tutorials
    #saheli tutorial
    #beauty Tips
    #duppata Tips
    #Dupatta styles
    #dupatta for girls
    # use of Dupatta
    #Stylish top beauty tips
    #Attractive Dupata
    #Attractive Dupata syles
    #dupatta Style 2019
    #duptta style 2019
    #how to drape a dupatta
    #Dupatta in 5 Different ways
    #wear Dupatta
    #How to wear Dupatta in 5 Different ways
    #wear Dupatta
    #Dupatta in 5 Different ways
    #dupatta face cover in sun rays 2019
    # use of dupatta
    # dupatta 2019
    #Dupatta in 5 Different style
    #DIY Style
    #How to use Dupatta
    #how to wear dupatta?
    #how to wear dupatta
    #new style of dupatta wearing

    #use of Dupaata
    #dupatta Dress
    #hacks dupatta
    #duppata Drap
    #drap your dupaata
    #drap Duppata
    #dupatta Hacks
    saree videos ;-

    Watch how to wear dupatta in different styles ?Style Dupatta in Different Ways.use of dupatta for girls With HD Quality

    By Saheli Tutorials| 652 views

  • Skin Care Routine for Dark Spots, Pigmentation | Pigmentation Treatment at home | JSuper Kaur

    Skin Care Routine for Dark Spots, Pigmentation | Pigmentation Treatment at home | JSuper Kaur

    1. Mamaearth Link :
    2. Amazon Link :

    Camera Used :

    Vlog Camera :

    My Fav Lipstick Colour :

    Shooting Lights :

    Ring Light :

    Tripod Used :


    For Make & Beauty Tips Subscribe to my other channel

    Super Beauty :

    Follow me on all social media & be my Friend! Please do Like, Subscribe & Share :-

    * YouTube :
    * Facebook :
    * Instagram :
    * Twitter :
    * Google+ :
    * Website :

    For Business Inquiries -

    E Mail :

    Much Love

    By JSuper kaur| 299 views

  • Easy & Glowy Festive / Durga Puja / Wedding Guest Makeup Using Affordable Products for Beginners

    Easy & Glowy Festive / Durga Puja / Wedding Guest Makeup Using Affordable Products for Beginners

    Make sure to like comment and subscribe to my channel
    Products shown in the video are -

    Jewellery -

    1. Blue Heaven Primer - Rs. 220

    2. Swiss Beauty Brow Palette - Rs. 199

    3. Europe Girl Concealer - Caramel - Rs. 350(Buy Now for rs. 325)

    4. Europe Girl Mineralize Skin Finish - Rs. 650(now for Rs. 550)

    5. SFR City Mini Eyeshadow Palette - Rs. 150

    6. Swiss Beauty Metallic liquid Eyeshadow - Shade 04 - Rs. 199

    7. Blue Heaven Liquid Eyeliner - Rs. 50

    8. Bonjour Eyelashes - Rs. 50

    9. Maybelline Fit Loose Powder - light Medium

    10. DYF Brushes - Rs. 250

    11. SFR Bronzer, contour, highlighter , blush Palette - Rs. 150(shade 1 i have used in the video)

    12. Kajrare Mascara - Rs. 55

    13. SFR Modern Go! Go! Go! Eyeshadow - Rs. 115

    14. Blue heaven color fun lipstick in 505 - Rs. 125

    15. Shystyles lock it Forget it Natural Finish Makeup Setting Spray Rs. 399

    By Nidhi Katiyar| 869 views



    Follow me on my social media:


    Digitally Powered by One Digital Entertainment []
    [Website -]


    By Neha Desai| 121097 views

  • Aukaat | Waqt Sabka Badalta Hai | गरीब vs अमीर | The Unexpected Twist | Indian SwaggersUp next

    Aukaat | Waqt Sabka Badalta Hai | गरीब vs अमीर | The Unexpected Twist | Indian Swaggers

    Concept based on "Waqt Sabka Badalta Hai" New Video by Indian Swaggers in which a guy plays a brilliant role गरीब Boyfriend when and fall in love with अमीर Girlfriend and then time changes .
    Sumit Dhiran
    Aniket karan
    Neha Jangra
    Rahul Thakur

    Do subscribe this channel - Bekrazy
    ( )
    Join us on social media accounts :-

    For Brand Sponsor and Collab -
    If I uploaded a song that's yours and you want it removed just contact me through my E-mail or just send YouTube message .

    Managed by-
    #waqtsabkabadaltahai #qismat

    Disclaimer - This video is just for Fun and making you all laugh. I make video only to entertain people and make them laugh . People don't get offended by video . Because it is just for the purpose of entertainment . Thank You for Watching....
    Don't Forget to Subscribe & Hit the bell to watch more Latest Desi Funny Videos of Indian Swaggers

    Watch Aukaat | Waqt Sabka Badalta Hai | गरीब vs अमीर | The Unexpected Twist | Indian Swaggers With HD Quality

    By Indian Swaggers| 2257 views

  • Aukaat | गरीब vs अमीर | Roadpati Bana Crorepati | Waqt Sabka Badalta hai | Indian Swaggers

    Aukaat | गरीब vs अमीर | Roadpati Bana Crorepati | Waqt Sabka Badalta hai | Indian Swaggers

    Join us on social media accounts :-

    For Brand Sponsor and Collab -
    If I uploaded a song that's yours and you want it removed just contact me through my E-mail or just send YouTube message .

    Managed by-
    #roadpatibanacrorepati #waqtsabkabadaltahai

    Disclaimer - This video is just for Fun and making you all laugh. I make video only to entertain people and make them laugh . People don't get offended by video . Because it is just for the purpose of entertainment . Thank You for Watching....
    Don't Forget to Subscribe & Hit the bell to watch more Latest Desi Funny Videos of Indian Swaggers

    Watch Aukaat | गरीब vs अमीर | Roadpati Bana Crorepati | Waqt Sabka Badalta hai | Indian Swaggers With HD Quality

    By Indian Swaggers| 1299 views

  • गरीब Vs अमीर | Qismat | Waqt Sabka Badalta hai | Time Changes | Aukaat | Indian Swaggers

    गरीब Vs अमीर | Qismat | Waqt Sabka Badalta hai | Time Changes | Aukaat | Indian Swaggers

    Concept based on "Waqt Sabka Badalta Hai" New Video by Indian Swaggers.

    Download Ballebaazi app:
    Manage by:
    ( )

    Sumit Dhiran
    Aniket karan
    chandni Jah
    Rahul thakur

    Join us on social media accounts :-

    For Brand Sponsor and Collab -
    If I uploaded a song that's yours and you want it removed just contact me through my E-mail or just send YouTube message .
    #waqtsabkabadaltahai #garibvsamir #aukaat

    Disclaimer - This video is just for Fun and making you all laugh. I make video only to entertain people and make them laugh . People don't get offended by video . Because it is just for the purpose of entertainment . Thank You for Watching....
    Don't Forget to Subscribe & Hit the bell to watch more Latest Desi Funny Videos of Indian Swaggers

    Watch गरीब Vs अमीर | Qismat | Waqt Sabka Badalta hai | Time Changes | Aukaat | Indian Swaggers With HD Quality

    By Indian Swaggers| 959 views

  • गरीब Vs अमीर | Bezzati | गरीब का मजाक | Aukaat | Waqt Sabka Badalta hai | Time Changes

    गरीब Vs अमीर | Bezzati | गरीब का मजाक | Aukaat | Waqt Sabka Badalta hai | Time Changes

    Concept based on "Waqt Sabka Badalta Hai" New Video by Indian Swaggers in which a guy plays a brilliant role गरीब Boyfriend when and fall in love with अमीर Girlfriend and then time changes .
    Sumit Dhiran
    Aniket karan
    Neha Jangra
    Rahul Thakur
    Child Appearance - (Monty And Puchu)
    Do subscribe this channel - Bekrazy

    Join us on social media accounts :-

    For Brand Sponsor and Collab -
    If I uploaded a song that's yours and you want it removed just contact me through my E-mail or just send YouTube message .

    Managed by-
    #waqtsabkabadaltahai #qismat

    Disclaimer - This video is just for Fun and making you all laugh. I make video only to entertain people and make them laugh . People don't get offended by video . Because it is just for the purpose of entertainment . Thank You for Watching....
    Don't Forget to Subscribe & Hit the bell to watch more Latest Desi Funny Videos of Indian Swaggers

    Watch गरीब Vs अमीर | Bezzati | गरीब का मजाक | Aukaat | Waqt Sabka Badalta hai | Time Changes With HD Quality

    By Indian Swaggers| 681 views

  • गरीब vs अमीर | Waqt Sabka Badalta Hai | Aukaat | Qismat | गरीब का मज़ाक | Time Changes

    गरीब vs अमीर | Waqt Sabka Badalta Hai | Aukaat | Qismat | गरीब का मज़ाक | Time Changes

    Concept based on "Waqt Sabka Badalta Hai" New Video by Indian Swaggers in which a guy plays a brilliant role गरीब Boyfriend when and fall in love with अमीर Girlfriend and then time changes .
    Sumit Dhiran
    Aniket karan
    Rahul thakur.
    Rahul singh

    Join us on social media accounts :-

    For Brand Sponsor and Collab -
    If I uploaded a song that's yours and you want it removed just contact me through my E-mail or just send YouTube message .

    Managed by-
    #roadpatibanacrorepati #aukaat #waqtsabkabadaltahai

    Disclaimer - This video is just for Fun and making you all laugh. I make video only to entertain people and make them laugh . People don't get offended by video . Because it is just for the purpose of entertainment . Thank You for Watching....
    Don't Forget to Subscribe & Hit the bell to watch more Latest Desi Funny Videos of Indian Swaggers

    Watch गरीब vs अमीर | Waqt Sabka Badalta Hai | Aukaat | Qismat | गरीब का मज़ाक | Time Changes With HD Quality

    By Indian Swaggers| 212 views

  • गरीब vs अमीर | Time Changes | गरीब का मज़ाक | Waqt Sabka Badalta Hai | Aukaat | Qismat

    गरीब vs अमीर | Time Changes | गरीब का मज़ाक | Waqt Sabka Badalta Hai | Aukaat | Qismat

    Concept based on "Waqt Sabka Badalta Hai" New Video by Indian Swaggers in which a guy plays a brilliant role गरीब Boyfriend when and fall in love with अमीर Girlfriend
    Watch गरीब vs अमीर | Time Changes | गरीब का मज़ाक | Waqt Sabka Badalta Hai | Aukaat | Qismat With HD Quality

    By Indian Swaggers| 219 views

  • Waqt Sabka Badalta Hai | गरीब Boyfriend अमीर Girlfriend | 10वीं फेल बना करोड़पति | Indian Swaggers

    Waqt Sabka Badalta Hai | गरीब Boyfriend अमीर Girlfriend | 10वीं फेल बना करोड़पति | Indian Swaggers

    10वीं फेल बना करोड़पति Concept based on "Waqt Sabka Badalta Hai" New Video by Indian Swaggers in which a guy plays a brilliant role when it was shows that life after गरीब vs अमीर .
    Sumit Dhiran
    Aniket karan
    Himanshu Dabas
    Rahul thakur

    Join us on social media accounts :-

    For Brand Sponsor and Collab -
    If I uploaded a song that's yours and you want it removed just contact me through my E-mail or just send YouTube message .

    Watch Waqt Sabka Badalta Hai | गरीब Boyfriend अमीर Girlfriend | 10वीं फेल बना करोड़पति | Indian Swaggers With HD Quality

    By Indian Swaggers| 2607 views

  • Waqt Sabka Badalta Hai | गरीब और अमीर दोस्त की कहानी  | Thukra Ke Mera Pyar | Indian Swaggers

    Waqt Sabka Badalta Hai | गरीब और अमीर दोस्त की कहानी | Thukra Ke Mera Pyar | Indian Swaggers

    So this Concept based on "Waqt Sabka Badalta Hai" New Video 2019 by Indian Swaggers in which a Aniket Plays a brilliant role when he was (गरीब) poor and ask his rich friend ( अमीर दोस्त ) to help him and shows love to his beloved but don't het return in favour.

    Sumit Dhiran
    Aniket karan

    Join us on social media accounts :-

    For Brand Sponsor and Collab -

    Do subscribe this channel -

    If I uploaded a song that's yours and you want it to be removed so just contact me through my E-mail or just send YouTube message .

    Managed by-
    #waqtsabkabadaltahai #inteqam #yaarateriyaari

    Don't Forget to Subscribe & Hit the bell to watch more Latest Desi Funny Videos of Indianswagger

    Watch Waqt Sabka Badalta Hai | गरीब और अमीर दोस्त की कहानी | Thukra Ke Mera Pyar | Indian Swaggers With HD Quality

    By Indian Swaggers| 2687 views

  • गरीब Boyfriend अमीर Girlfriend | Waqt Sabka Badalta Hai | Paisa Ya Pyar | Indian Swaggers

    गरीब Boyfriend अमीर Girlfriend | Waqt Sabka Badalta Hai | Paisa Ya Pyar | Indian Swaggers

    Paisa Ya Pyar Concept based on "Waqt Sabka Badalta Hai" New Video by Indian Swaggers in which a guy plays a brilliant role गरीब Boyfriend when and fall in love with अमीर Girlfriend and then time changes .
    Sumit Dhiran
    Aniket karan

    Do subscribe this channel -

    Join us on social media accounts :-

    For Brand Sponsor and Collab -
    If I uploaded a song that's yours and you want it removed just contact me through my E-mail or just send YouTube message .

    Managed by-
    #waqtsabkabadaltahai #paisayapyar

    Disclaimer - This video is just for Fun and making you all laugh. I make video only to entertain people and make them laugh . People don't get offended by video . Because it is just for the purpose of entertainment . Thank You for Watching....
    Don't Forget to Subscribe & Hit the bell to watch more Latest Desi Funny Videos of Indian Swaggers

    Watch गरीब Boyfriend अमीर Girlfriend | Waqt Sabka Badalta Hai | Paisa Ya Pyar | Indian Swaggers With HD Quality

    By Indian Swaggers| 1150 views

Zara Hat Ke

  • Asaduddin Owaisi Funniest Speech Mein Hindustan Ka Hero Hu | @ SACH NEWS |

    Asaduddin Owaisi Funniest Speech Mein Hindustan Ka Hero Hu | @ SACH NEWS |

    Join Whatsapp Group :

    Mobile = 9963089906

    Twitter =

    Facebook =

    Google+ =

    Instagram =

    Watch Asaduddin Owaisi Funniest Speech Mein Hindustan Ka Hero Hu | @ SACH NEWS | With HD Quality

    By Sach News| 89 views

  • डॉ राकेश ने डोर टू डोर जाकर लोगों से मांगा जनसमर्थन HAR NEWS 24

    डॉ राकेश ने डोर टू डोर जाकर लोगों से मांगा जनसमर्थन HAR NEWS 24

    डॉ राकेश ने डोर टू डोर जाकर लोगों से मांगा जनसमर्थन
    Welcome to the official HAR News 24 YouTube channel.

    Interested in global news with an impartial perspective? Want to see behind-the-scenes clips and footage directly from the front-line? Our YouTube channel has all this and more, bringing you specially selected clips from the world's most trusted news source.

    Watch डॉ राकेश ने डोर टू डोर जाकर लोगों से मांगा जनसमर्थन HAR NEWS 24 With HD Quality

    By HAR NEWS| 75 views

  • Breaking News :- Mumbai के अंधेरी वीरा देसाई रोड पर पेनिनसुलर बिल्डिंग में लगी आग

    Breaking News :- Mumbai के अंधेरी वीरा देसाई रोड पर पेनिनसुलर बिल्डिंग में लगी आग

    #breakingnews #News #mumbainews

    Breaking News :- Mumbai के अंधेरी वीरा देसाई रोड पर पेनिनसुलर बिल्डिंग में लगी आग

    मुंबई के अँधेरी में आग लगने से पुरे इलाके में हड़कंप मच गया जिसके कारण आमजान में दहसत का माहौल हो बन गया

    Navtej Tv is peoples hindi channel, your channel. The most honest and growing national news channel that covers latest trending news, hindi news Bulletin, in depth coverage of news stories, Indian film industry , latest Bollywood updates. We primary focus on ground level reporting and serious news.

    Navtej Tv has Dedicated specialized programs related to politics, Business, corporates talk shows, education and sports.

    Find the latest updates also on our website :

    Do come and like us on our facebook page:

    Our Twitter handle:

    We help our viewers stay updated and satisfy the appetite of information and news.
    Join us and Subscribe the Channel to be notified.

    Watch Breaking News :- Mumbai के अंधेरी वीरा देसाई रोड पर पेनिनसुलर बिल्डिंग में लगी आग With HD Quality

    By Navtej TV| 86 views

  • What Happening In Telangana | TSRTC Strike | CM KCR | Telugu News | Top Telugu TV

    What Happening In Telangana | TSRTC Strike | CM KCR | Telugu News | Top Telugu TV

    Telugu, Language Channel owned by Bhavitha Sri Media House Pvt Ltd.

    And Subscribe My Channels
    1)Top Telugu TV









    Follow ...


    Twitter :


    Instagram: What Happening In Telangana | TSRTC Strike | CM KCR | Telugu News | Top Telugu TV With HD Quality

    By Top Telugu TV| 73 views

  • TechNews in telugu 474: realme Os,Redmi note 9,Pubg hyderabad,amazon offers,realme x2 pro,MIUI 11

    TechNews in telugu 474: realme Os,Redmi note 9,Pubg hyderabad,amazon offers,realme x2 pro,MIUI 11

    TechNews in telugu miui 11 device list in india #telugutechtuts
    Sign up link –
    Amazon link –
    Flipkart link –

    Watch TechNews in telugu 474: realme Os,Redmi note 9,Pubg hyderabad,amazon offers,realme x2 pro,MIUI 11 With HD Quality

    By Telugu TechTuts| 127 views

  • पश्चिम बंगाल में निर्दोष हिन्दुओ की हत्याओं के विरोध में मऊरानीपुर में बजरंग दल के कार्यकर्ताओ ने कि

    पश्चिम बंगाल में निर्दोष हिन्दुओ की हत्याओं के विरोध में मऊरानीपुर में बजरंग दल के कार्यकर्ताओ ने कि

    यूपी ताजा न्यूज पर पूरी खबर विस्तार से -

    अगर आपके पास कोई ऑडियो वीडियो हो जो आप यूपी ताजा न्यूज़ तक पहुंचाना चाहें तो हमें Whatsapp करें 9264904092 पर या आप हमसे संपर्क करें

    गनपत सिंह महान
    For Donation
    Install UP TAAZA NEWS android App
    Website -
    Facebook Page -


    Amazon Link -
    Flipkart Link -

    #Bundelkhand #BundeliNews
    TAJA Khabar
    taja khabar
    taja news
    hindi news
    bundeli News
    Bundelkhand news

    Watch पश्चिम बंगाल में निर्दोष हिन्दुओ की हत्याओं के विरोध में मऊरानीपुर में बजरंग दल के कार्यकर्ताओ ने कि With HD Quality

    By UP TAAZA NEWS| 55 views

  • Karva Chauth- करवा चौथ - Special | जानिए क्यो है इस बार का व्रत खास

    Karva Chauth- करवा चौथ - Special | जानिए क्यो है इस बार का व्रत खास

    Karva Chauth (करवा चौथ) is a festival celebrated by Hindu women in many countries in which married women fast from sunrise to moonrise for the safety and longevity of their husbands.

    song - Ghar Aaja Pardesi
    Pamela Chopra, Manpreet Kaur, Chorus

    Watch Karva Chauth- करवा चौथ - Special | जानिए क्यो है इस बार का व्रत खास With HD Quality

    By DPK NEWS| 492 views

  • Fat to Fit Chest Workout! Day-27 (Hindi / Punjabi)

    Fat to Fit Chest Workout! Day-27 (Hindi / Punjabi)

    Our other video of Best Natural FAT LOSS Supplement:

    Here is a Top 5 Fat loss tips video:

    Here is a Fat Loss Diet Plan:

    Here is a Fat Loss Vegetarian Diet Plan:

    Trick to Lose Face Fat:

    All diet plans are in Diet Plan Playlist:

    ***Find 100's of videos in our Playlists!***

    Visit our website:

    If you have questions, message us on our Fa

    By MY BOLLYWOOD BODY| 13065 views

  • Uttar Pradesh blast news सिलिंडर ब्लास्ट से दहल सभी  , 13 लोगों की मौत

    Uttar Pradesh blast news सिलिंडर ब्लास्ट से दहल सभी , 13 लोगों की मौत

    यूपी के मऊ में सिलेंडर ब्लास्ट से 12 की मौत,Follow us on
    The News India is a popular Hindi News Channel in Telangana and Andhrapradesh made its in March 2015.

    The vision of the channel is "'voice of truth &courage' -the promise of keeping each individual ahead and informed. The News India is best defined as a responsible channel with a fair and balanced approach that combines prompt reporting with insightful analysis of news and current affairs.

    The News India maintains the repute of being a people's channel. At THE NEWS INDIA , we believe that the truth, which is at the core of news,is
    sacred and we have a stated policy that we will not shock, titillate, scare and
    distort. Therefore, we don’t telecast crime shows, sexually-oriented content or
    Programs that promote superstition, alarm, fear, loathe and absurdity.
    We not only focus on the life of the metros and the Urban India, but also
    covers the Bharat of non-metros, tier II and III towns, as well as villages
    wherever news is happening.

    Watch Uttar Pradesh blast news सिलिंडर ब्लास्ट से दहल सभी , 13 लोगों की मौत With HD Quality

    By The News India| 125 views

  • मुम्बई आगरा नेशनल हाइवे 3 पर  लहसुन से भरे ट्रक मे लगी शार्ट सर्किट से भीषण आग | #bn #bhartiyanews

    मुम्बई आगरा नेशनल हाइवे 3 पर लहसुन से भरे ट्रक मे लगी शार्ट सर्किट से भीषण आग | #bn #bhartiyanews


    Bardwani / Madhya Pradesh

    Watch मुम्बई आगरा नेशनल हाइवे 3 पर लहसुन से भरे ट्रक मे लगी शार्ट सर्किट से भीषण आग | #bn #bhartiyanews With HD Quality

    By Bhartiya News| 118 views

Indian Swaggers

  • गरीब और अमीर दोस्त की कहानी | Aukaat | Waqt Sabka Badalta Hai | गरीब vs अमीर | Indian Swaggers

    गरीब और अमीर दोस्त की कहानी | Aukaat | Waqt Sabka Badalta Hai | गरीब vs अमीर | Indian Swaggers

    Concept based on "Waqt Sabka Badalta Hai" New Video by Indian Swaggers in which a guy plays a brilliant role गरीब Boyfriend when and fall in love with अमीर Girlfriend

    Watch गरीब और अमीर दोस्त की कहानी | Aukaat | Waqt Sabka Badalta Hai | गरीब vs अमीर | Indian Swaggers With HD Quality

    By Indian Swaggers| 147 views

  • गरीब vs अमीर | Time Changes | गरीब का मज़ाक | Waqt Sabka Badalta Hai | Aukaat | Qismat

    गरीब vs अमीर | Time Changes | गरीब का मज़ाक | Waqt Sabka Badalta Hai | Aukaat | Qismat

    Concept based on "Waqt Sabka Badalta Hai" New Video by Indian Swaggers in which a guy plays a brilliant role गरीब Boyfriend when and fall in love with अमीर Girlfriend
    Watch गरीब vs अमीर | Time Changes | गरीब का मज़ाक | Waqt Sabka Badalta Hai | Aukaat | Qismat With HD Quality

    By Indian Swaggers| 219 views

  • गरीब vs अमीर | Waqt Sabka Badalta Hai | Aukaat | Qismat | गरीब का मज़ाक | Time Changes

    गरीब vs अमीर | Waqt Sabka Badalta Hai | Aukaat | Qismat | गरीब का मज़ाक | Time Changes

    Concept based on "Waqt Sabka Badalta Hai" New Video by Indian Swaggers in which a guy plays a brilliant role गरीब Boyfriend when and fall in love with अमीर Girlfriend and then time changes .
    Sumit Dhiran
    Aniket karan
    Rahul thakur.
    Rahul singh

    Join us on social media accounts :-

    For Brand Sponsor and Collab -
    If I uploaded a song that's yours and you want it removed just contact me through my E-mail or just send YouTube message .

    Managed by-
    #roadpatibanacrorepati #aukaat #waqtsabkabadaltahai

    Disclaimer - This video is just for Fun and making you all laugh. I make video only to entertain people and make them laugh . People don't get offended by video . Because it is just for the purpose of entertainment . Thank You for Watching....
    Don't Forget to Subscribe & Hit the bell to watch more Latest Desi Funny Videos of Indian Swaggers

    Watch गरीब vs अमीर | Waqt Sabka Badalta Hai | Aukaat | Qismat | गरीब का मज़ाक | Time Changes With HD Quality

    By Indian Swaggers| 212 views


  • Netherland के राजा-ऱानी ने Manish Sisodiya के साथ Delhi के सरकारी स्कूलों का लिया जायजा

    Netherland के राजा-ऱानी ने Manish Sisodiya के साथ Delhi के सरकारी स्कूलों का लिया जायजा

    Netherland के राजा-ऱानी ने Manish Sisodiya के साथ Delhi के सरकारी स्कूलों का लिया जायजा

    To Subscribe on Youtube:

    Follow us on Twitter :

    Like us on FB:

    Watch Netherland के राजा-ऱानी ने Manish Sisodiya के साथ Delhi के सरकारी स्कूलों का लिया जायजा With HD Quality

    By PunjabKesari TV| 53 views

  • Karva Chauth Vrat Katha in Hindi, Karwa Chauth Fast story

    Karva Chauth Vrat Katha in Hindi, Karwa Chauth Fast story

    Watch Karva Chauth Vrat Katha in Hindi, Karwa Chauth Fast story With HD Quality

    By Harry| 10670 views

  • PM Shri Narendra Modi addresses public meeting in Partur, Maharashtra #ModifiedMaharashtra

    PM Shri Narendra Modi addresses public meeting in Partur, Maharashtra #ModifiedMaharashtra

    Subscribe Now - Stay Updated! ????

    • Facebook -
    • Twitter -
    • Instagram -
    • Linkedin-

    Watch PM Shri Narendra Modi addresses public meeting in Partur, Maharashtra #ModifiedMaharashtra With HD Quality

    By Bharatiya Janata Party Delhi| 73 views

  • NCR's air quality worsens as farmers continue to burn crop stubble

    NCR's air quality worsens as farmers continue to burn crop stubble

    Air quality in northern India, particularly Delhi, is expected to deteriorate to very dangerous levels after a week because of lower temperature and increased burning of harvest residue in the region, but for the next two days favourable wind will prevent the flow of smoke into the capital.

    ► Subscribe to The Economic Times for latest video updates. It's free! -

    ► More Videos @ ETTV -


    ► For business news on the go, download ET app:

    Follow ET on:

    ► Facebook -
    ► Twitter -
    ► LinkedIn -
    ► Instagram -
    ► Flipboard -

    The Economic Times | A Times Internet Limited product

    Watch NCR's air quality worsens as farmers continue to burn crop stubble With HD Quality

    By The Economic Times| 208 views

  • GST और नोटबंदी से किसे फायदा हुआ ?

    GST और नोटबंदी से किसे फायदा हुआ ?

    GST और नोटबंदी से किसे फायदा हुआ ?

    This video is an intellectual property belonging to the Indian National Congress. Please seek prior permission before using any part of this video in any form.

    For more videos, subscribe to Congress Party channel:

    Follow Indian National Congress!

    Follow the Indian National Congress on

    Follow Rahul Gandhi on


    Watch GST और नोटबंदी से किसे फायदा हुआ ? With HD Quality

    By Indian National Congress| 80 views