Ranveer Singh An Deepika Padukone MOBBED By MEDIA At Airport | Ranveer-Deepika Marriage In Italy

Ad 30s Skip Ad in 5s -Skip Ad-
Visit advertiser site
  • Deepika Padukone And Ranveer Singh GRAND WELCOME In Mumbai After Marriage In Italy

    Deepika Padukone And Ranveer Singh GRAND WELCOME In Mumbai After Marriage In Italy

    Deepika Padukone And Ranveer Singh GRAND WELCOME In Mumbai After Marriage In Italy

    #BollywoodSpy #BollywoodNews #BollywoodGossips - Stay Tuned For More Bollywood News

    Check All Bollywood Latest Update on our Channel

    Subscribe to our Channel https://goo.gl/UerBDn

    Like us on Facebook https://goo.gl/7Q896J

    Follow us on Twitter https://goo.gl/AjQfa4

    Circle us on G+ https://goo.gl/57XqjC

    Follow us on Instagram https://goo.gl/x48yEy

    Watch Deepika Padukone And Ranveer Singh GRAND WELCOME In Mumbai After Marriage In Italy With HD Quality

    By Bollywood Spy| 1457 views

  • Ranveer and Deepika Padukone Reception Full Video Part 1 ||  Deepika Padukone Marriage

    Ranveer and Deepika Padukone Reception Full Video Part 1 || Deepika Padukone Marriage

    Watch Ranveer and Deepika Padukone Reception Full Video Part 1 || Deepika Padukone Marriage With HD Quality

    By TSP Kannada TV| 2386 views

  • Italy Gay Marriage: Italy condemned for violating gay rights over marriage

    Italy Gay Marriage: Italy condemned for violating gay rights over marriage

    The European Court of Human Rights has condemned Italy for failing to provide adequate legal protection for same-sex couples...IN THE NEWS THIS WEEK WITH ANN AND ANDY (taped 11-26-14): Federal judges overturn bans on same-sex marriage in Mississippi and Arkansas.

    The idiot Westboro Baptist Church unintentionally declared it's hatred of the Ivory Coast. In an effort to protest Ireland's legalization of same-sex marriage, church ...

    US Supreme Court rules gay marriage is legal nationwide The US Supreme Court has ruled that same-sex marriage is a legal right across the United States.

    By asif| 256 views

  • Italy Gay Marriage: Italy breaches rights over gay marriage - European court

    Italy Gay Marriage: Italy breaches rights over gay marriage - European court

    Italy violates human rights by failing to offer enough legal protection for same-sex couples, a European court has ruled.

    Judges said the government had breached the rights of three gay couples by refusing them marriage or any other recognised form of union.

    Italy is the only major Western European country with no civil partnerships or gay marriage.

    Prime Minister Matteo Renzi has long promised to pass a law on civil unions.

    By asif| 236 views

  • SRIDEVI- Ranveer Singh And Deepika Padukone MOBBED At Anil Kapoor House

    SRIDEVI- Ranveer Singh And Deepika Padukone MOBBED At Anil Kapoor House

    SRIDEVI: Ranveer Singh And Deepika Padukone MOBBED At Anil Kapoor House - Stay Tuned For More Bollywood News

    Check All Bollywood Latest Update on our Channel

    Subscribe to our Channel https://goo.gl/UerBDn

    Like us on Facebook https://goo.gl/7Q896J

    Follow us on Twitter https://goo.gl/AjQfa4

    Circle us on G+ https://goo.gl/57XqjC

    Follow us on Instagram https://goo.gl/x48yEy

    Watch SRIDEVI- Ranveer Singh And Deepika Padukone MOBBED At Anil Kapoor House With HD Quality

    By Bollywood Spy| 635 views

  • Ranveer Singh - Deepika Padukone Royal Wedding In Italy - Exclusive First Picture

    Ranveer Singh - Deepika Padukone Royal Wedding In Italy - Exclusive First Picture

    Ranveer - Deepika Wedding In Italy - Exclusive First Picture

    #RanveerDeepikaWedding #RanveerSingh #DeepikaPadukone

    Watch Ranveer Singh - Deepika Padukone Royal Wedding In Italy - Exclusive First Picture With HD Quality

    By BOLLYWOOD FLASH| 9677 views

  • Deepika Padukone Ranveer Singh return to Mumbai after their wedding in Lake Como, Italy

    Deepika Padukone Ranveer Singh return to Mumbai after their wedding in Lake Como, Italy

    Watch Deepika Padukone, Ranveer Singh return to Mumbai after their wedding in Lake Como, Italy With HD Quality

    Deepika Padukone, Ranveer Singh return to Mumbai after their wedding in Lake Como, Italy
    Follow us on:

    YouTube: https://www.youtube.com/TV24NewsIndia

    Twitter: https://twitter.com/TV24India

    Facebook: http://www.facebook.com/TV24channel

    Website : www.LiveTV24.tv

    Tv24 news channel
    Tv24 news
    Breaking news
    viral in india
    trending in india
    Hindi khabar
    News tak

    By TV24 News Channel| 3311 views

  • Newlyweds Deepika and Ranveer get mobbed at the Airport

    Newlyweds Deepika and Ranveer get mobbed at the Airport

    Ranveer Singh and Deepika Padukone who tied the knot in Italy were recently spotted at Mumbai airport as they returned and got mobbed by their fans.

    Check out the video to know more

    SUBSCRIBE To Bollywood Bubble:
    Click Here ► http://bit.ly/2hjMB6X

    Tune into Bollywood Bubble, your one stop destination for all the latest happenings, hot gossips, rumours and exclusive B-Town news...

    Also, Visit - https://www.bollywoodbubble.com . One stop Destination for Latest Bollywood Updates.

    Like us on Facebook - https://www.facebook.com/BollywoodBubble

    Follow us on Twitter - https://twitter.com/bollybubble

    Follow us on Instagram - www.instagram.com/bollywoodbubble

    Click On the Subscribe Button NOW and Stay Tuned.Watch Newlyweds Deepika and Ranveer get mobbed at the Airport With HD Quality

    By Bollywood Bubble| 3234 views

  • Ranveer Singh MOBBED By His FANS Outside Club - Crazy FANS Of Ranveer Singh

    Ranveer Singh MOBBED By His FANS Outside Club - Crazy FANS Of Ranveer Singh

    Ranveer Singh MOBBED By His FANS Outside Club - Crazy FANS Of Ranveer Singh - Stay Tuned For More Bollywood News

    Check All Bollywood Latest Update on our Channel

    Subscribe to our Channel https://goo.gl/UerBDn

    Like us on Facebook https://goo.gl/7Q896J

    Follow us on Twitter https://goo.gl/AjQfa4

    Circle us on G+ https://goo.gl/57XqjC

    Follow us on Instagram https://goo.gl/x48yEy

    Watch Ranveer Singh MOBBED By His FANS Outside Club - Crazy FANS Of Ranveer Singh With HD Quality

    By Bollywood Spy| 809 views

Bollywood Spy's image
Published on: Nov 10, 2018

Ranveer Singh An Deepika Padukone MOBBED By MEDIA At Airport | Ranveer-Deepika Marriage In Italy

#BollywoodSpy #BollywoodNews #BollywoodGossips - Stay Tuned For More Bollywood News

Check All Bollywood Latest Update on our Channel

Subscribe to our Channel https://goo.gl/UerBDn

Like us on Facebook https://goo.gl/7Q896J

Follow us on Twitter https://goo.gl/AjQfa4

Circle us on G+ https://goo.gl/57XqjC

Follow us on Instagram https://goo.gl/x48yEy

Watch Ranveer Singh An Deepika Padukone MOBBED By MEDIA At Airport | Ranveer-Deepika Marriage In Italy With HD Quality

#MediaAttacksOnRanveerSinghCar  #AttacksOnRanveerSinghCar  #RanveerSingh  #RanveerDeepikaMarriage  #ranveerdeepikamarriagevideo  #ranveerdeepikamarriagedate  #ranveerdeepikamarriagenews  #ranveerdeepikamarriagezoom  #ranveerdeepikamarriagereaction  #ranveerdeepikamarriageinterview  #ranveerdeepikamarriageprediction  #ranveerdeepikamarriagecard  #deepikapadukonemarriage  #ranveersinghwedding  #deepikapadukonewedding  #ranveerdeepikawedding  #deepveer  



Show More [+]
Show Less [-]
Size : x pixels
  • Deepika Padukone And Ranveer Singh GRAND WELCOME In Mumbai After Marriage In ItalyUp next

    Deepika Padukone And Ranveer Singh GRAND WELCOME In Mumbai After Marriage In Italy

    Deepika Padukone And Ranveer Singh GRAND WELCOME In Mumbai After Marriage In Italy

    #BollywoodSpy #BollywoodNews #BollywoodGossips - Stay Tuned For More Bollywood News

    Check All Bollywood Latest Update on our Channel

    Subscribe to our Channel https://goo.gl/UerBDn

    Like us on Facebook https://goo.gl/7Q896J

    Follow us on Twitter https://goo.gl/AjQfa4

    Circle us on G+ https://goo.gl/57XqjC

    Follow us on Instagram https://goo.gl/x48yEy

    Watch Deepika Padukone And Ranveer Singh GRAND WELCOME In Mumbai After Marriage In Italy With HD Quality

    By Bollywood Spy| 1457 views

  • Ranveer and Deepika Padukone Reception Full Video Part 1 ||  Deepika Padukone Marriage

    Ranveer and Deepika Padukone Reception Full Video Part 1 || Deepika Padukone Marriage

    Watch Ranveer and Deepika Padukone Reception Full Video Part 1 || Deepika Padukone Marriage With HD Quality

    By TSP Kannada TV| 2386 views

  • Italy Gay Marriage: Italy condemned for violating gay rights over marriage

    Italy Gay Marriage: Italy condemned for violating gay rights over marriage

    The European Court of Human Rights has condemned Italy for failing to provide adequate legal protection for same-sex couples...IN THE NEWS THIS WEEK WITH ANN AND ANDY (taped 11-26-14): Federal judges overturn bans on same-sex marriage in Mississippi and Arkansas.

    The idiot Westboro Baptist Church unintentionally declared it's hatred of the Ivory Coast. In an effort to protest Ireland's legalization of same-sex marriage, church ...

    US Supreme Court rules gay marriage is legal nationwide The US Supreme Court has ruled that same-sex marriage is a legal right across the United States.

    By asif| 256 views

  • Italy Gay Marriage: Italy breaches rights over gay marriage - European court

    Italy Gay Marriage: Italy breaches rights over gay marriage - European court

    Italy violates human rights by failing to offer enough legal protection for same-sex couples, a European court has ruled.

    Judges said the government had breached the rights of three gay couples by refusing them marriage or any other recognised form of union.

    Italy is the only major Western European country with no civil partnerships or gay marriage.

    Prime Minister Matteo Renzi has long promised to pass a law on civil unions.

    By asif| 236 views

  • SRIDEVI- Ranveer Singh And Deepika Padukone MOBBED At Anil Kapoor House

    SRIDEVI- Ranveer Singh And Deepika Padukone MOBBED At Anil Kapoor House

    SRIDEVI: Ranveer Singh And Deepika Padukone MOBBED At Anil Kapoor House - Stay Tuned For More Bollywood News

    Check All Bollywood Latest Update on our Channel

    Subscribe to our Channel https://goo.gl/UerBDn

    Like us on Facebook https://goo.gl/7Q896J

    Follow us on Twitter https://goo.gl/AjQfa4

    Circle us on G+ https://goo.gl/57XqjC

    Follow us on Instagram https://goo.gl/x48yEy

    Watch SRIDEVI- Ranveer Singh And Deepika Padukone MOBBED At Anil Kapoor House With HD Quality

    By Bollywood Spy| 635 views

  • Ranveer Singh - Deepika Padukone Royal Wedding In Italy - Exclusive First Picture

    Ranveer Singh - Deepika Padukone Royal Wedding In Italy - Exclusive First Picture

    Ranveer - Deepika Wedding In Italy - Exclusive First Picture

    #RanveerDeepikaWedding #RanveerSingh #DeepikaPadukone

    Watch Ranveer Singh - Deepika Padukone Royal Wedding In Italy - Exclusive First Picture With HD Quality

    By BOLLYWOOD FLASH| 9677 views

  • Deepika Padukone Ranveer Singh return to Mumbai after their wedding in Lake Como, Italy

    Deepika Padukone Ranveer Singh return to Mumbai after their wedding in Lake Como, Italy

    Watch Deepika Padukone, Ranveer Singh return to Mumbai after their wedding in Lake Como, Italy With HD Quality

    Deepika Padukone, Ranveer Singh return to Mumbai after their wedding in Lake Como, Italy
    Follow us on:

    YouTube: https://www.youtube.com/TV24NewsIndia

    Twitter: https://twitter.com/TV24India

    Facebook: http://www.facebook.com/TV24channel

    Website : www.LiveTV24.tv

    Tv24 news channel
    Tv24 news
    Breaking news
    viral in india
    trending in india
    Hindi khabar
    News tak

    By TV24 News Channel| 3311 views

  • Newlyweds Deepika and Ranveer get mobbed at the Airport

    Newlyweds Deepika and Ranveer get mobbed at the Airport

    Ranveer Singh and Deepika Padukone who tied the knot in Italy were recently spotted at Mumbai airport as they returned and got mobbed by their fans.

    Check out the video to know more

    SUBSCRIBE To Bollywood Bubble:
    Click Here ► http://bit.ly/2hjMB6X

    Tune into Bollywood Bubble, your one stop destination for all the latest happenings, hot gossips, rumours and exclusive B-Town news...

    Also, Visit - https://www.bollywoodbubble.com . One stop Destination for Latest Bollywood Updates.

    Like us on Facebook - https://www.facebook.com/BollywoodBubble

    Follow us on Twitter - https://twitter.com/bollybubble

    Follow us on Instagram - www.instagram.com/bollywoodbubble

    Click On the Subscribe Button NOW and Stay Tuned.Watch Newlyweds Deepika and Ranveer get mobbed at the Airport With HD Quality

    By Bollywood Bubble| 3234 views

  • Ranveer Singh MOBBED By His FANS Outside Club - Crazy FANS Of Ranveer Singh

    Ranveer Singh MOBBED By His FANS Outside Club - Crazy FANS Of Ranveer Singh

    Ranveer Singh MOBBED By His FANS Outside Club - Crazy FANS Of Ranveer Singh - Stay Tuned For More Bollywood News

    Check All Bollywood Latest Update on our Channel

    Subscribe to our Channel https://goo.gl/UerBDn

    Like us on Facebook https://goo.gl/7Q896J

    Follow us on Twitter https://goo.gl/AjQfa4

    Circle us on G+ https://goo.gl/57XqjC

    Follow us on Instagram https://goo.gl/x48yEy

    Watch Ranveer Singh MOBBED By His FANS Outside Club - Crazy FANS Of Ranveer Singh With HD Quality

    By Bollywood Spy| 809 views

Bollywood Spy

  • Hrithik Roshan Sweet Gesture Towards His Fan During WAR Promotion Will Melt Your Heart

    Hrithik Roshan Sweet Gesture Towards His Fan During WAR Promotion Will Melt Your Heart

    Hrithik Roshan Sweet Gesture Towards His Fan During WAR Promotion Will Melt Your Heart
    #hrithikroshak #war - Stay Tuned For More Bollywood News

    ☞ Check All Bollywood Latest Update on our Channel

    ☞ Subscribe to our Channel https://goo.gl/UerBDn

    ☞ Like us on Facebook https://goo.gl/7Q896J

    ☞ Follow us on Twitter https://goo.gl/AjQfa4

    ☞ Circle us on G+ https://goo.gl/57XqjC

    ☞ Follow us on Instagram https://goo.gl/x48yEy

    Watch Hrithik Roshan Sweet Gesture Towards His Fan During WAR Promotion Will Melt Your Heart With HD Quality

    By Bollywood Spy| 13 views

  • Jai Jai Shivshankar PUBLIC REACTION | Tiger Vs Hrithik | WAR

    Jai Jai Shivshankar PUBLIC REACTION | Tiger Vs Hrithik | WAR

    Jai Jai Shivshankar PUBLIC REACTION | Tiger Vs Hrithik | WAR
    #war #jaijaishivshankar #hrithikroshan - Stay Tuned For More Bollywood News

    ☞ Check All Bollywood Latest Update on our Channel

    ☞ Subscribe to our Channel https://goo.gl/UerBDn

    ☞ Like us on Facebook https://goo.gl/7Q896J

    ☞ Follow us on Twitter https://goo.gl/AjQfa4

    ☞ Circle us on G+ https://goo.gl/57XqjC

    ☞ Follow us on Instagram https://goo.gl/x48yEy

    Watch Jai Jai Shivshankar PUBLIC REACTION | Tiger Vs Hrithik | WAR With HD Quality

    By Bollywood Spy| 21 views

  • Main Zaroor Aaunga | Hot Sensous Song Launch | Andrita Ray And Vikas Verma

    Main Zaroor Aaunga | Hot Sensous Song Launch | Andrita Ray And Vikas Verma

    Main Zaroor Aaunga | Hot Sensous Song Launch | Andrita Ray And Vikas Verma
    #BollywoodSpy #BollywoodNews #BollywoodGossips - Stay Tuned For More Bollywood News

    ☞ Check All Bollywood Latest Update on our Channel

    ☞ Subscribe to our Channel https://goo.gl/UerBDn

    ☞ Like us on Facebook https://goo.gl/7Q896J

    ☞ Follow us on Twitter https://goo.gl/AjQfa4

    ☞ Circle us on G+ https://goo.gl/57XqjC

    ☞ Follow us on Instagram https://goo.gl/x48yEy

    Watch Main Zaroor Aaunga | Hot Sensous Song Launch | Andrita Ray And Vikas Verma With HD Quality

    By Bollywood Spy| 18 views


  • how to wear dupatta in different styles ?Style Dupatta in  Different Ways.use of dupatta for girls

    how to wear dupatta in different styles ?Style Dupatta in Different Ways.use of dupatta for girls

    Hi Guys!
    In this video I'm showing how to style your dupatta different ways. I hope you all enjoy! Which one is your favorite look? Comment below .)

    Duptta, saree, juda(Bun) isi type ke videos ke channel ko subscibe karen
    # sahelitutorials #dupttastyle
    #Style Dupatta
    #saheli tutorials
    #saheli tutorial
    #beauty Tips
    #duppata Tips
    #Dupatta styles
    #dupatta for girls
    # use of Dupatta
    #Stylish top beauty tips
    #Attractive Dupata
    #Attractive Dupata syles
    #dupatta Style 2019
    #duptta style 2019
    #how to drape a dupatta
    #Dupatta in 5 Different ways
    #wear Dupatta
    #How to wear Dupatta in 5 Different ways
    #wear Dupatta
    #Dupatta in 5 Different ways
    #dupatta face cover in sun rays 2019
    # use of dupatta
    # dupatta 2019
    #Dupatta in 5 Different style
    #DIY Style
    #How to use Dupatta
    #how to wear dupatta?
    #how to wear dupatta
    #new style of dupatta wearing

    #use of Dupaata
    #dupatta Dress
    #hacks dupatta
    #duppata Drap
    #drap your dupaata
    #drap Duppata
    #dupatta Hacks
    saree videos ;- https://youtu.be/Q3E-f94B8lU

    Watch how to wear dupatta in different styles ?Style Dupatta in Different Ways.use of dupatta for girls With HD Quality

    By Saheli Tutorials| 226 views

  • TCM Scar Removal For Acne Marks,Scars And Stretch Marks

    TCM Scar Removal For Acne Marks,Scars And Stretch Marks

    #sinhala #beautywithsumu #srilankanbeautytherapist #lanbenatcm #acnescarremoval #stretchmarksremoval
    Hey Beauties
    As you guys ask here is the best product for acne marks,scars,stretch marks and old scars .So hope you will like this video and Don't forget to hit the SUBSCRIBE button

    Contact my business page for a best quality beauty products

    You can catch me on
    facebook https://www.facebook.com/beautysumu/
    instagram https://www.instagram.com/beautywiths...
    email beautywithsumu@gmail.com

    Watch TCM Scar Removal For Acne Marks,Scars And Stretch Marks With HD Quality

    By Beauty with Sumu| 58 views

  • Lakme Fashion Week Winter Festive 2015 - Day 4 | Arjun Rampal And Sooraj Pancholi Walk The Ramp

    Lakme Fashion Week Winter Festive 2015 - Day 4 | Arjun Rampal And Sooraj Pancholi Walk The Ramp

    The Day 4 of Lakme Fashion Week Winter Festive 2015 showcased something for every body shape in a bright horse-motif collection by designer Masaba Gupta. Catch Arjun Rampal and Sooraj Pancholi walking the runway displaying some amazing collections of their favorite designers.
    Click To Share On Facebook: https://goo.gl/kKnyD9
    Click To Share On Twitter: https://goo.gl/MizPwW
    Click To Share On Google+: https://goo.gl/PMd2yU

    Send in your entries to karanjohar@livfame.com or http://www.livfame.com/schoolofstyle

    Subscribe to us on http://www.youtube.com/subscription_center?add_user=fameschoolofstyle

    Like us on http://www.facebook.com/famesos

    Follow us on http://www.twitter.com/livyourfame

    Register on http://www.livfame.com
    To view more exciting Live beams, Download the #fame App or visit: https://go.onelink.me/2709712807?pid=YT&c=Description
    #fame- Go Live & Be A Star| Watch & Discover Live Videos | Follow & Chat Live With Celebs & #famestars - Anywhere, Anytime!
    Stay Connected with #fame on:
    Facebook: https://www.facebook.com/LiveOnfame
    Twitter: https://www.twitter.com/LiveOnfame
    Instagram: https://www.instagram.com/LiveOnfame
    Snapchat: liveonfameWatch Lakme Fashion Week Winter Festive 2015 - Day 4 | Arjun Rampal And Sooraj Pancholi Walk The Ramp With HD Quality

    By fame School Of Style| 18890 views

  • Garba Night / Durga Puja / Festive Makeup Look using new affordable makeup | Pink & yellow Makeup

    Garba Night / Durga Puja / Festive Makeup Look using new affordable makeup | Pink & yellow Makeup

    5. Swiss Beauty intense gel kajal - green - Rs. 299( currently on offer rs. 249)

    6. SFR Color Bronzer, blush highlight palette - Rs. 150

    7. Blue heaven Colorful creamy matte lip color - shade #511

    8. Kajrare mascara - Rs. 55

    9. SFR COlor matte eyeshadow palette - Rs. 115( the one shown is out of stock)

    10. Bounkour eyelashes no. 011 - Rs. 50

    Follow me on all my social media's below:
    email :prettysimplenk@gmail.com
    Facebook: https://www.facebook.com/prettysimplenk/
    Twitter : https://twitter.com/prettysimplenk
    Instagram - https://www.instagram.com/nidhi.167/

    What I am Wearing -

    My Filming Equipments -
    1. Generic tripod from Amazon
    2. Nikon D5200
    3. Rode Micro Mic

    By Nidhi Katiyar| 82 views

  • Prolixr Perfect Skin Detoxifying Face Mask Review|Instagram Viral Face Mask!

    Prolixr Perfect Skin Detoxifying Face Mask Review|Instagram Viral Face Mask!

    The Prolixr Perfect Skin Detoxifying Sea Algae Mask has gone viral on Instagram! 

    You can buy the product at 40% off here, which is Rs.1490!! 

    Check out Prolixr on Social Media:
    Instagram: @prolixr
    https:// www.facebook.com/prolixr/
    http:// www.twitter.com/prolixrofficial/

    Visit Prolixr's Website:
    Music: Who Can Say, Youtube Audio Library.
    Follow me on my social media:
    Facebook: https://www.facebook.com/nehadesai21/
    Instagram: @nehadesai.blog

    Watch Prolixr Perfect Skin Detoxifying Face Mask Review|Instagram Viral Face Mask! With HD Quality

    By Neha Desai| 433 views

  • Underarms Whitening at home | How to lighten Dark Underarms | JSuper kaur

    Underarms Whitening at home | How to lighten Dark Underarms | JSuper kaur

    underarms whitening
    underarms whitening at home
    underarms hair removal
    underarms removal
    underarms dark
    underarms lighten dark

    Camera Used : https://amzn.to/318ppMI

    Vlog Camera : https://amzn.to/2QLo5e3

    My Fav Lipstick Colour : https://amzn.to/2WQz7E4
    : https://amzn.to/2WHV9sR
    : https://amzn.to/2QNDzOF
    : https://amzn.to/2Kr07n6

    Shooting Lights : https://amzn.to/2ETZ5fL

    Ring Light : https://amzn.to/31ldcVc

    Tripod Used : https://amzn.to/2WMVA4W


    By JSuper kaur| 47 views


  • Motor Vehicle Act को लेकर सरकार के खिलाफ सड़को पर उतरा Delhi का Transport union

    Motor Vehicle Act को लेकर सरकार के खिलाफ सड़को पर उतरा Delhi का Transport union

    #MotorVehicleAct #delhiMotorVehicleAct #Transportunion

    Navtej Tv has Dedicated specialized programs related to politics, Business, corporates talk shows, education and sports.

    Find the latest updates also on our website : http://navtejtv.in/

    Do come and like us on our facebook page: https://www.facebook.com/Navtej-TV-2315975242024769

    Our Twitter handle: https://twitter.com/NavtejTv

    We help our viewers stay updated and satisfy the appetite of

    By Navtej TV| 89 views

  • Nirmala Sitharaman ने  Corporate tax पर छूट की भी की घोषणा | nirmala sitharaman press conference

    Nirmala Sitharaman ने Corporate tax पर छूट की भी की घोषणा | nirmala sitharaman press conference

    Nirmala Sitharaman ने Corporate tax पर छूट की भी की घोषणा | nirmala sitharaman press conference
    गिरती अर्थव्यवस्था और बढ़ती बेरोजगारी को लेकर विपक्ष लगातार सरकार पर निशाना साध रहा है.,.लेकिन सरकार आर्थिक मंदी का ठीकरा किसी और पर फोड़ रही है...जिसके चलते पिछली दिनों सरकार की खूब फजीहत भी हुई...लेकिन अब इस मुद्दे पर चौतरफा घिरने के बाद मोदी सरकार नींद से जागती नजर आ रही है...जिसके मद्देनजर आज केंद्रीय वित्तमंत्री निर्मला सीतारमण ने बड़े ऐलान कर कारोबारियों को राहत देने की कोशिश की है...तो क्या किए वित्तमंत्री ने ऐलान,,,,इस रिपोर्ट में देखिए....
    #HindiNews | #BreakingNews | #Watch | #video |

    DB LIVE APP : https://play.google.com/store/apps/details?id=dblive.tv.news.dblivetv.com
    DB LIVE TV : http://dblive.tv/
    SUBSCRIBE TO OUR CHANNEL: https://www.youtube.com/channel/UCBbpLKJLhIbDd_wX4ubU_Cw
    DESHBANDHU : http://www.deshbandhu.co.in/
    FACEBOOK : https://www.facebook.com/DBlivenews/
    TWITTER : https://twitter.com/dblive15
    ENTERTAINMENT LIVE : https://www.youtube.com/channel/UCyX4qQhpz8WQP2Iu7jzHGFQ
    Sports Live : https://www.youtube.com/channel/UCHgCkbxlMRgMrjUtvMmBojg

    Watch Nirmala Sitharaman ने Corporate tax पर छूट की भी की घोषणा | nirmala sitharaman press conference With HD Quality

    By DB Live| 103 views

  • #RAJNEETI ||देखें #UTTAR_PARDESH में कहां-कहां होंगे उप-चुनाव ? || #JANTATV

    #RAJNEETI ||देखें #UTTAR_PARDESH में कहां-कहां होंगे उप-चुनाव ? || #JANTATV

    उपचुनाव (Bypoll) से पहले यूपी की योगी आदित्यनाथ (Yogi Adityanath) सरकार को इलाहाबाद हाईकोर्ट (Allahabad High Court) से बड़ा झटका लगा है. इलाहाबाद हाईकोर्ट ने ओबीसी की 17 जातियों को अनुसूचित जाति में शामिल करने के योगी सरकार के शासनादेश पर रोक लगा दी है. हाईकोर्ट ने पहली नजर में राज्य सरकार के फैसले को गलत मानते हुए प्रमुख सचिव (समाज कल्याण) मनोज कुमार सिंह से व्यक्तिगत हलफनामा मांगा है

    जनता टीवी न्‍यूज चैनल राजनीति, मनोरंजन, बॉलीवुड, व्यापार और खेल में नवीनतम समाचारों को शामिल करता है। जनता टीवी न्‍यूज चैनल की लाइव खबरें एवं ब्रेकिंग न्यूज के लिए बने रहें । Janta TV Live TV | Hindi News LIVE 24X7 | जनता टीवी लाइव टीवी | हिंदी खबर 24X7 LIVE
    Janta TV is Best Hindi News Channel in Haryana, Punjab & Himachal. Janta TV news channel covers the latest news in politics, entertainment, Bollywood, business and sports. Stay tuned for all the breaking news in Hindi! Subscribe To Our Channel: https://www.youtube.com/c/jantatvnews Official website: http://jantatv.com/ Like us on Facebook https://www.facebook.com/JantaTvNews/ Follow us on Twitter https://twitter.com/jantatv_news

    Watch #RAJNEETI ||देखें #UTTAR_PARDESH में कहां-कहां होंगे उप-चुनाव ? || #JANTATV With HD Quality

    By Janta TV| 49 views

  • रेप के आरोपी चिन्मयानंद ने दो घंटे में ही ने उगल दिया सच, बोले "मैं शर्मिंदा हूं, गलती हो गई।"

    रेप के आरोपी चिन्मयानंद ने दो घंटे में ही ने उगल दिया सच, बोले "मैं शर्मिंदा हूं, गलती हो गई।"

    बीजेपी के पूर्व नेता स्वामी चिन्मयानंद को एसआईटी ने उनके आश्रम से गिरफ्तार कर लिया है, फिलहाल उन्हें 14 दिन की न्यायिक हिरासत में भेजा गया है। स्वामी चिन्मयानंद पर उन्ही के कॉलेज की एक छात्रा ने यौन शोषण का आरोप लगाया था, छात्रा ने ये भी कहा था ना केवल वो बल्कि और भी कई छात्राओं का चिन्मयानन्द द्वारा शोषण किया गया। SIT ने दावा किया है कि रेप के आरोपी चिन्मयानन्द ने अपना गुनाह कबूल किया, कहा- "मैं शर्मिंदा हूं, गलती हो गई।"
    #स्वामीचिन्मयानन्द #लॉछात्रा #SIT #एसएसकॉलेज #SwamiChinmayanand #lawstudent #SSCollege #ChinmayanandViralVideo

    To Subscribe on Youtube: 


    Follow us on Twitter :

    Like us on FB:

    Watch रेप के आरोपी चिन्मयानंद ने दो घंटे में ही ने उगल दिया सच, बोले "मैं शर्मिंदा हूं, गलती हो गई।" With HD Quality

    By PunjabKesari TV| 531 views

  • कौन थे Mai Bhago, जिनका ज़िक्र गीत में करके बुरे फसे Sidhu Moosewala

    कौन थे Mai Bhago, जिनका ज़िक्र गीत में करके बुरे फसे Sidhu Moosewala

    कौन थे Mai Bhago, जिनका ज़िक्र गीत में करके बुरे फसे Sidhu Moosewala

    By Dainik Savera| 134 views